• Gene id: 54956

Gene Summary

• Gene Symbol: PARP16   Gene   UCSC   Ensembl
• Aliases: ARTD15, C15orf30, pART15
• Gene name: poly(ADP-ribose) polymerase family member 16
• Alternate names: protein mono-ADP-ribosyltransferase PARP16, ADP-ribosyltransferase diphtheria toxin-like 15, PARP-16, mono [ADP-ribose] polymerase PARP16, poly [ADP-ribose] polymerase 16,
• Gene location: 15q22.31 (65286890: 65231690)     Exons: 1     NC_000015.10

Protein Summary

• Protein general information: Q8N5Y8  
  • Name: Protein mono ADP ribosyltransferase PARP16 (EC 2.4.2. ) (ADP ribosyltransferase diphtheria toxin like 15) (Poly [ADP ribose] polymerase 16) (PARP 16)
  • Length: 322  
  • Mass: 36383
• Sequence:

  MQPSGWAAAREAAGRDMLAADLRCSLFASALQSYKRDSVLRPFPASYARGDCKDFEALLADASKLPNLKELLQSS
  GDNHKRAWDLVSWILSSKVLTIHSAGKAEFEKIQKLTGAPHTPVPAPDFLFEIEYFDPANAKFYETKGERDLIYA
  FHGSRLENFHSIIHNGLHCHLNKTSLFGEGTYLTSDLSLALIYSPHGHGWQHSLLGPILSCVAVCEVIDHPDVKC
  QTKKKDSKEIDRRRARIKHSEGGDIPPKYFVVTNNQLLRVKYLLVYSQKPPKRASSQLSWFSSHWFTVMISLYLL
  LLLIVSVINSSAFQHFWNRAKR

• Structural information:
  • Protein Domains: (5..9-)
    (/note="PARP-alpha-helical)
    (94..27-)
    (/note="PARP-catalytic)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00397"-)
  • Interpro: IPR041400  IPR012317  
  • Prosite: PS51059
  • PDB: 4F0D 6HXR 6HXS
  • PDBsum: 4F0D 6HXR 6HXS
  • STRING: ENSP00000261888
• Other Databases: GeneCards:  PARP16  Malacards:  PARP16

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0006471	protein ADP-ribosylation	IBA	biological process
GO:0030968	endoplasmic reticulum unfolded protein response	IBA	biological process
GO:0043539	protein serine/threonine kinase activator activity	IBA	molecular function
GO:0071782	endoplasmic reticulum tubular network	IBA	cellular component
GO:0003950	NAD+ ADP-ribosyltransferase activity	IBA	molecular function
GO:0005635	nuclear envelope	IBA	cellular component
GO:0019900	kinase binding	IBA	molecular function
GO:0140289	protein mono-ADP-ribosylation	IDA	biological process
GO:1990404	protein ADP-ribosylase activity	IDA	molecular function
GO:0070213	protein auto-ADP-ribosylation	IDA	biological process
GO:0003950	NAD+ ADP-ribosyltransferase activity	IEA	molecular function
GO:0006986	response to unfolded protein	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0034356	NAD biosynthesis via nicotinamide riboside salvage pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:1990830	cellular response to leukemia inhibitory factor	IEA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005635	nuclear envelope	IDA	cellular component
GO:0019900	kinase binding	IPI	molecular function
GO:0019900	kinase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003950	NAD+ ADP-ribosyltransferase activity	IMP	molecular function
GO:0071782	endoplasmic reticulum tubular network	IMP	cellular component
GO:0060548	negative regulation of cell death	IMP	biological process
GO:0030968	endoplasmic reticulum unfolded protein response	IMP	biological process
GO:0005783	endoplasmic reticulum	IMP	cellular component
GO:0071902	positive regulation of protein serine/threonine kinase activity	IMP	biological process
GO:0070213	protein auto-ADP-ribosylation	IMP	biological process
GO:0070213	protein auto-ADP-ribosylation	IMP	biological process
GO:0036498	IRE1-mediated unfolded protein response	IMP	biological process
GO:0003950	NAD+ ADP-ribosyltransferase activity	IMP	molecular function
GO:0016020	membrane	HDA	cellular component
GO:0043539	protein serine/threonine kinase activator activity	IMP	molecular function
GO:0006471	protein ADP-ribosylation	IMP	biological process
GO:0006471	protein ADP-ribosylation	IMP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq