Male Infertility Database

Search Result

Gene id

54953

Gene Summary Protein Summary Gene ontology Diseases PubMed

Gene Summary

Gene Symbol

ODR4 Gene UCSC Ensembl

Aliases

C1orf27, TTG1, odr-4

Gene name

odr-4 GPCR localization factor homolog

Alternate names

protein odr-4 homolog, LAG1-interacting protein, odorant response abnormal 4, transactivated by recombinant transforming growth factor beta, transactivated by recombinant transforming growth factor beta 1, transactivated by transforming growth factor beta prot,

Gene location

1q31.1 (186375757: 186421374) Exons: 15 NC_000001.11

OMIM

609335

Protein Summary

Protein general information

Q5SWX8

Name: Protein odr 4 homolog (hODR 4) (LAG1 interacting protein) (Transactivated by transforming growth factor beta protein 1)

Length: 454 Mass: 51103

Tissue specificity: Ubiquitously expressed. {ECO

Sequence

MGRTYIVEETVGQYLSNINLQGKAFVSGLLIGQCSSQKDYVILATRTPPKEEQSENLKHPKAKLDNLDEEWATEH
ACQVSRMLPGGLLVLGVFIITTLELANDFQNALRRLMFAVEKSINRKRLWNFTEEEVSERVTLHICASTKKIFCR
TYDIHDPKSSARPADWKYQSGLSSSWLSLECTVHINIHIPLSATSVSYTLEKNTKNGLTRWAKEIENGVYLINGQ
VKDEDCDLLEGQKKSSRGNTQATSHSFDVRVLTQLLLNSDHRSTATVQICSGSVNLKGAVKCRAYIHSSKPKVKD
AVQAVKRDILNTVADRCEMLFEDLLLNEIPEKKDSEKEFHVLPYRVFVPLPGSTVMLCDYKFDDESAEEIRDHFM
EMLDHTIQIEDLEIAEETNTACMSSSMNSQASLDNTDDEQPKQPIKTTMLLKIQQNIGVIAAFTVAVLAAGISFH
YFSD

Structural information

Interpro:	IPR029454
STRING:	ENSP00000287859

Other Databases

GeneCards: ODR4 Malacards: ODR4

Gene ontology

Expand All | Collapse All

GO accession	Term name	Evidence code	Go category
GO:0008104	protein localization	IBA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of mem brane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Expand All | Collapse All

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

Expand All | Collapse All

PMID	Condition	Population details	Infertility_type	Associated_genes	Abstract
17327269	Teratozoos permia	19 (6 controls , 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)	Show abstract
28606200	Cryptorchi dism	Monozgotic twin s (1 control, I cwith cryptorc hidism)	Male infertility	MeDIP-Seq	Show abstract
25753583	Unexplaine d infertil ity	46 (17 fertile men, 29 male pa tients)	Male infertility	Microarray	Show abstract

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

Diseases

Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

Diseases Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Diseases

Expand All | Collapse All