• Gene id: 5495

Gene Summary

• Gene Symbol: PPM1B   Gene   UCSC   Ensembl
• Aliases: PP2C-beta, PP2C-beta-X, PP2CB, PP2CBETA, PPC2BETAX
• Gene name: protein phosphatase, Mg2+/Mn2+ dependent 1B
• Alternate names: protein phosphatase 1B, Ser/Thr protein phosphatase type 2C beta 2 isoform, protein phosphatase 1B (formerly 2C), magnesium-dependent, beta isoform, protein phosphatase 2C-like protein,
• Gene location: 2p21 (44168802: 44247329)     Exons: 9     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase has been shown to dephosphorylate cyclin-dependent
• OMIM: 603770

Protein Summary

• Protein general information: O75688  
  • Name: Protein phosphatase 1B (EC 3.1.3.16) (Protein phosphatase 2C isoform beta) (PP2C beta)
  • Length: 479  
  • Mass: 52643
  • Tissue specificity: Highly expressed in heart and skeletal muscle.
• Sequence:

  MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPHGLEDWSFFAVYDGHAGSRVANYCSTHL
  LEHITTNEDFRAAGKSGSALELSVENVKNGIRTGFLKIDEYMRNFSDLRNGMDRSGSTAVGVMISPKHIYFINCG
  DSRAVLYRNGQVCFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPE
  VYEILRAEEDEFIILACDGIWDVMSNEELCEYVKSRLEVSDDLENVCNWVVDTCLHKGSRDNMSIVLVCFSNAPK
  VSDEAVKKDSELDKHLESRVEEIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRNVIEAVYSRLNPHRE
  SDGASDEAEESGSQGKLVEALRQMRINHRGNYRQLLEEMLTSYRLAKVEGEESPAEPAATATSSNSDAGNPVTMQ
  ESHTESESGLAELDSSNEDAGTKMSGEKI

• Structural information:
  • Protein Domains: (23..29-)
    (/note="PPM-type-phosphatase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01082"-)
  • Interpro: IPR015655  IPR000222  IPR012911  IPR036580  IPR036457   IPR001932  
  • Prosite: PS01032 PS51746
  • CDD: cd00143
  • PDB: 2P8E
  • PDBsum: 2P8E
  • STRING: ENSP00000282412
• Other Databases: GeneCards:  PPM1B  Malacards:  PPM1B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004722	protein serine/threonine phosphatase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0090263	positive regulation of canonical Wnt signaling pathway	IBA	biological process
GO:0004724	magnesium-dependent protein serine/threonine phosphatase activity	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0043124	negative regulation of I-kappaB kinase/NF-kappaB signaling	IBA	biological process
GO:0050687	negative regulation of defense response to virus	IMP	biological process
GO:0043124	negative regulation of I-kappaB kinase/NF-kappaB signaling	IMP	biological process
GO:0006499	N-terminal protein myristoylation	ISS	biological process
GO:0006470	protein dephosphorylation	IMP	biological process
GO:0006470	protein dephosphorylation	IMP	biological process
GO:0005829	cytosol	ISS	cellular component
GO:1901223	negative regulation of NIK/NF-kappaB signaling	IMP	biological process
GO:0032688	negative regulation of interferon-beta production	IMP	biological process
GO:0016020	membrane	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0000287	magnesium ion binding	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0030145	manganese ion binding	IEA	molecular function
GO:0043169	cation binding	IEA	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0004722	protein serine/threonine phosphatase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004722	protein serine/threonine phosphatase activity	TAS	molecular function
GO:0006470	protein dephosphorylation	TAS	biological process
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0004722	protein serine/threonine phosphatase activity	IDA	molecular function
GO:0035970	peptidyl-threonine dephosphorylation	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04010	MAPK signaling pathway

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R