• Gene id: 54947

Gene Summary

• Gene Symbol: LPCAT2   Gene   UCSC   Ensembl
• Aliases: AGPAT11, AYTL1, LysoPAFAT
• Gene name: lysophosphatidylcholine acyltransferase 2
• Alternate names: lysophosphatidylcholine acyltransferase 2, 1-AGP acyltransferase 11, 1-AGPAT 11, 1-acylglycerol-3-phosphate O-acyltransferase 11, 1-acylglycerophosphocholine O-acyltransferase, 1-alkylglycerophosphocholine O-acetyltransferase, LPAAT-alpha, LPC acyltransferase 2, ,
• Gene location: 16q12.2 (55509054: 55586665)     Exons: 17     NC_000016.10
• Gene summary(Entrez): This gene encodes a member of the lysophospholipid acyltransferase family. The encoded enzyme may function in two ways: to catalyze the biosynthesis of platelet-activating factor (1-O-alkyl-2-acetyl-sn-glycero-3-phosphocholine) from 1-O-alkyl-sn-glycero-3
• OMIM: 609937

Protein Summary

• Protein general information: Q7L5N7  
  • Name: Lysophosphatidylcholine acyltransferase 2 (LPC acyltransferase 2) (LPCAT 2) (LysoPC acyltransferase 2) (EC 2.3.1.23) (1 acylglycerol 3 phosphate O acyltransferase 11) (1 AGP acyltransferase 11) (1 AGPAT 11) (EC 2.3.1.51) (1 acylglycerophosphocholine O acy
  • Length: 544  
  • Mass: 60208
• Sequence:

  MSRCAQAAEVAATVPGAGVGNVGLRPPMVPRQASFFPPPVPNPFVQQTQIGSARRVQIVLLGIILLPIRVLLVAL
  ILLLAWPFAAISTVCCPEKLTHPITGWRRKITQTALKFLGRAMFFSMGFIVAVKGKIASPLEAPVFVAAPHSTFF
  DGIACVVAGLPSMVSRNENAQVPLIGRLLRAVQPVLVSRVDPDSRKNTINEIIKRTTSGGEWPQILVFPEGTCTN
  RSCLITFKPGAFIPGVPVQPVLLRYPNKLDTVTWTWQGYTFIQLCMLTFCQLFTKVEVEFMPVQVPNDEEKNDPV
  LFANKVRNLMAEALGIPVTDHTYEDCRLMISAGQLTLPMEAGLVEFTKISRKLKLDWDGVRKHLDEYASIASSSK
  GGRIGIEEFAKYLKLPVSDVLRQLFALFDRNHDGSIDFREYVIGLAVLCNPSNTEEIIQVAFKLFDVDEDGYITE
  EEFSTILQASLGVPDLDVSGLFKEIAQGDSISYEEFKSFALKHPEYAKIFTTYLDLQTCHVFSLPKEVQTTPSTA
  SNKVSPEKHEESTSDKKDD

• Structural information:
  • Protein Domains: (391..42-)
    (/note="EF-hand-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (428..46-)
    (/note="EF-hand-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448"-)
  • Interpro: IPR011992  IPR018247  IPR002048  IPR002123  
  • Prosite: PS00018 PS50222
  • CDD: cd00051
  • STRING: ENSP00000262134
• Other Databases: GeneCards:  LPCAT2  Malacards:  LPCAT2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0047184	1-acylglycerophosphocholine O-acyltransferase activity	IDA	molecular function
GO:0036151	phosphatidylcholine acyl-chain remodeling	IDA	biological process
GO:0005811	lipid droplet	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0003841	1-acylglycerol-3-phosphate O-acyltransferase activity	IDA	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0005811	lipid droplet	IEA	cellular component
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0008654	phospholipid biosynthetic process	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0047184	1-acylglycerophosphocholine O-acyltransferase activity	IEA	molecular function
GO:0050200	plasmalogen synthase activity	IEA	molecular function
GO:0003841	1-acylglycerol-3-phosphate O-acyltransferase activity	IEA	molecular function
GO:0047159	1-alkenylglycerophosphocholine O-acyltransferase activity	IEA	molecular function
GO:0047192	1-alkylglycerophosphocholine O-acetyltransferase activity	IEA	molecular function
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0036151	phosphatidylcholine acyl-chain remodeling	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0047192	1-alkylglycerophosphocholine O-acetyltransferase activity	IEA	molecular function
GO:0006663	platelet activating factor biosynthetic process	IEA	biological process
GO:0061024	membrane organization	IEA	biological process
GO:0047184	1-acylglycerophosphocholine O-acyltransferase activity	IEA	molecular function
GO:0005795	Golgi stack	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005811	lipid droplet	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005811	lipid droplet	IDA	cellular component
GO:0006644	phospholipid metabolic process	IEA	biological process
GO:0047192	1-alkylglycerophosphocholine O-acetyltransferase activity	ISS	molecular function
GO:0061024	membrane organization	ISS	biological process
GO:0047184	1-acylglycerophosphocholine O-acyltransferase activity	ISS	molecular function
GO:0006663	platelet activating factor biosynthetic process	ISS	biological process
GO:0005795	Golgi stack	ISS	cellular component
GO:0005783	endoplasmic reticulum	ISS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00564	Glycerophospholipid metabolism
hsa00565	Ether lipid metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881