• Gene id: 54943

Gene Summary

• Gene Symbol: DNAJC28   Gene   UCSC   Ensembl
• Aliases: C21orf55, C21orf78
• Gene name: DnaJ heat shock protein family (Hsp40) member C28
• Alternate names: dnaJ homolog subfamily C member 28, DnaJ (Hsp40) homolog, subfamily C, member 28,
• Gene location: 21q22.11 (33491722: 33488054)     Exons: 3     NC_000021.9
• Gene summary(Entrez): This gene encodes a member of the DnaJ heat shock protein family. The encoded protein, which contains a conserved N-terminal DnaJ domain, is thought to play a role in protein folding or act as a molecular chaperone protein. [provided by RefSeq, Oct 2016]

Protein Summary

• Protein general information: Q9NX36  
  • Name: DnaJ homolog subfamily C member 28
  • Length: 388  
  • Mass: 45806
  • Tissue specificity: Expressed in the fetal and adult brain, testis, uterus, spleen and liver.
• Sequence:

  MNTMYVMMAQILRSHLIKATVIPNRVKMLPYFGIIRNRMMSTHKSKKKIREYYRLLNVEEGCSADEVRESFHKLA
  KQYHPDSGSNTADSATFIRIEKAYRKVLSHVIEQTNASQSKGEEEEDVEKFKYKTPQHRHYLSFEGIGFGTPTQR
  EKHYRQFRADRAAEQVMEYQKQKLQSQYFPDSVIVKNIRQSKQQKITQAIERLVEDLIQESMAKGDFDNLSGKGK
  PLKKFSDCSYIDPMTHNLNRILIDNGYQPEWILKQKEISDTIEQLREAILVSRKKLGNPMTPTEKKQWNHVCEQF
  QENIRKLNKRINDFNLIVPILTRQKVHFDAQKEIVRAQKIYETLIKTKEVTDRNPNNLDQGEGEKTPEIKKGFLN
  WMNLWKFIKIRSF

• Structural information:
  • Protein Domains: (51..11-)
    (/note="J-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00286"-)
  • Interpro: IPR001623  IPR018961  IPR036869  
  • Prosite: PS50076
  • CDD: cd06257
  • STRING: ENSP00000479716
• Other Databases: GeneCards:  DNAJC28  Malacards:  DNAJC28

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006890	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	IBA	biological process
GO:0007030	Golgi organization	IBA	biological process
GO:0017119	Golgi transport complex	IBA	cellular component
GO:0048213	Golgi vesicle prefusion complex stabilization	IBA	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R