• Gene id: 54942

Gene Summary

• Gene Symbol: ABITRAM   Gene   UCSC   Ensembl
• Aliases: C9orf6, CG-8, FAM206A, Simiate
• Gene name: actin binding transcription modulator
• Alternate names: protein Abitram, family with sequence similarity 206 member A, protein FAM206A, protein Simiate,
• Gene location: 9q31.3 (108934396: 108950744)     Exons: 7     NC_000009.12

Protein Summary

• Protein general information: Q9NX38  
  • Name: Protein Abitram (Actin binding transcription modulator) (Protein Simiate)
  • Length: 181  
  • Mass: 20378
• Sequence:

  MATEPEAAEPVVPSLVDRYFTRWYKPDVKGKFCEDHCILQHSNRICVITLAESHPVLQSGKTIKSISYQISTNCS
  RLQNKVSGKFKRGAQFLTELAPLCKIYCSDGEEYTVSSCVRGRLMEVNENILHKPSILQEKPSTEGYIAVVLPKF
  EESKSITEGLLTQKQYEEVMVKRINATTATS

• Structural information:
  • Interpro: IPR039169  IPR033753  IPR011053  
  • STRING: ENSP00000363753
• Other Databases: GeneCards:  ABITRAM  Malacards:  ABITRAM

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051489	regulation of filopodium assembly	IBA	biological process
GO:0051015	actin filament binding	IBA	molecular function
GO:0048813	dendrite morphogenesis	IBA	biological process
GO:0032433	filopodium tip	IBA	cellular component
GO:0030425	dendrite	IBA	cellular component
GO:0003785	actin monomer binding	IBA	molecular function
GO:0030833	regulation of actin filament polymerization	IBA	biological process
GO:0030027	lamellipodium	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0051489	regulation of filopodium assembly	ISS	biological process
GO:0051015	actin filament binding	ISS	molecular function
GO:0032433	filopodium tip	ISS	cellular component
GO:0048813	dendrite morphogenesis	ISS	biological process
GO:0003785	actin monomer binding	ISS	molecular function
GO:0030426	growth cone	ISS	cellular component
GO:0030027	lamellipodium	ISS	cellular component
GO:0030833	regulation of actin filament polymerization	ISS	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030833	regulation of actin filament polymerization	IEA	biological process
GO:0030426	growth cone	IEA	cellular component
GO:0030027	lamellipodium	IEA	cellular component
GO:0016607	nuclear speck	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0051489	regulation of filopodium assembly	IEA	biological process
GO:0051015	actin filament binding	IEA	molecular function
GO:0048813	dendrite morphogenesis	IEA	biological process
GO:0032433	filopodium tip	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0003785	actin monomer binding	IEA	molecular function
GO:0030425	dendrite	IEA	cellular component
GO:0030027	lamellipodium	IEA	cellular component
GO:0016607	nuclear speck	IEA	cellular component
GO:0030426	growth cone	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)