• Gene id: 54941

Gene Summary

• Gene Symbol: RNF125   Gene   UCSC   Ensembl
• Aliases: TNORS, TRAC-1, TRAC1
• Gene name: ring finger protein 125
• Alternate names: E3 ubiquitin-protein ligase RNF125, T-cell RING activation protein 1, T-cell ring protein identified in activation screen, ring finger protein 125, E3 ubiquitin protein ligase,
• Gene location: 18q12.1 (32018584: 32090755)     Exons: 7     NC_000018.10
• Gene summary(Entrez): This gene encodes a novel E3 ubiquitin ligase that contains a RING finger domain in the N-terminus and three zinc-binding and one ubiquitin-interacting motif in the C-terminus. As a result of myristoylation, this protein associates with membranes and is p
• OMIM: 609651

Protein Summary

• Protein general information: Q96EQ8  
  • Name: E3 ubiquitin protein ligase RNF125 (EC 2.3.2.27) (RING finger protein 125) (T cell RING activation protein 1) (TRAC 1)
  • Length: 232  
  • Mass: 26454
  • Tissue specificity: Predominantly expressed in lymphoid tissues, including bone marrow, spleen and thymus. Also weakly expressed in other tissues. Predominant in the CD4(+) and CD8(+) T-cells, suggesting that it is preferentially confined to T-cells. {ECO
• Sequence:

  MGSVLSTDSGKSAPASATARALERRRDPELPVTSFDCAVCLEVLHQPVRTRCGHVFCRSCIATSLKNNKWTCPYC
  RAYLPSEGVPATDVAKRMKSEYKNCAECDTLVCLSEMRAHIRTCQKYIDKYGPLQELEETAARCVCPFCQRELYE
  DSLLDHCITHHRSERRPVFCPLCRLIPDENPSSFSGSLIRHLQVSHTLFYDDFIDFNIIEEALIRRVLDRSLLEY
  VNHSNTT

• Structural information:
  • Interpro: IPR008598  IPR034734  IPR001841  IPR013083  IPR017907  
  • Prosite: PS51803 PS00518 PS50089
  • PDB: 5DKA
  • PDBsum: 5DKA
  • DIP: 52778
  • STRING: ENSP00000217740
• Other Databases: GeneCards:  RNF125  Malacards:  RNF125

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0006511	ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0034098	VCP-NPL4-UFD1 AAA ATPase complex	IBA	cellular component
GO:0000209	protein polyubiquitination	IBA	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0061630	ubiquitin protein ligase activity	IDA	molecular function
GO:0006511	ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0061630	ubiquitin protein ligase activity	IDA	molecular function
GO:0061630	ubiquitin protein ligase activity	IDA	molecular function
GO:0008270	zinc ion binding	IDA	molecular function
GO:0034098	VCP-NPL4-UFD1 AAA ATPase complex	IDA	cellular component
GO:0032480	negative regulation of type I interferon production	IDA	biological process
GO:0039536	negative regulation of RIG-I signaling pathway	IDA	biological process
GO:0032480	negative regulation of type I interferon production	IDA	biological process
GO:0039536	negative regulation of RIG-I signaling pathway	IDA	biological process
GO:0000209	protein polyubiquitination	IDA	biological process
GO:0002039	p53 binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031624	ubiquitin conjugating enzyme binding	IPI	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0002250	adaptive immune response	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000139	Golgi membrane	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0000139	Golgi membrane	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04622	RIG-I-like receptor signaling pathway

Diseases

Associated diseases	References
Tenorio syndrome	KEGG:H01806
Tenorio syndrome	KEGG:H01806
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray