• Gene id: 54940

Gene Summary

• Gene Symbol: OCIAD1   Gene   UCSC   Ensembl
• Aliases: ASRIJ, OCIA, TPA018
• Gene name: OCIA domain containing 1
• Alternate names: OCIA domain-containing protein 1, ovarian cancer immunoreactive antigen domain containing 1, ovarian cancer immunoreactive antigen domain containing 1A, ovarian carcinoma immunoreactive antigen,
• Gene location: 4p11 (48830923: 48861816)     Exons: 0     NC_000004.12

Protein Summary

• Protein general information: Q9NX40  
  • Name: OCIA domain containing protein 1 (Ovarian cancer immunoreactive antigen domain containing 1) (Ovarian carcinoma immunoreactive antigen)
  • Length: 245  
  • Mass: 27626
  • Tissue specificity: Isoform 1 is highly expressed in many tissues, including testis, brain, placenta, ovary, prostate and mammary gland. Isoform 2 expression is restricted to the central nervous system including brain, cerebellum and spinal cord. {ECO
• Sequence:

  MNGRADFREPNAEVPRPIPHIGPDYIPTEEERRVFAECNDESFWFRSVPLAATSMLITQGLISKGILSSHPKYGS
  IPKLILACIMGYFAGKLSYVKTCQEKFKKLENSPLGEALRSGQARRSSPPGHYYQKSKYDSSVSGQSSFVTSPAA
  DNIEMLPHYEPIPFSSSMNESAPTGITDHIVQGPDPNLEESPKRKNITYEELRNKNRESYEVSLTQKTDPSVRPM
  HERVPKKEVKVNKYGDTWDE

• Structural information:
  • Protein Domains: (1..11-)
    (/note="OCIA"-)
  • Interpro: IPR040187  IPR009764  
  • STRING: ENSP00000370882
• Other Databases: GeneCards:  OCIAD1  Malacards:  OCIAD1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000736	regulation of stem cell differentiation	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0005768	endosome	IBA	cellular component
GO:0005768	endosome	ISS	cellular component
GO:2000736	regulation of stem cell differentiation	ISS	biological process
GO:0005768	endosome	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)