• Gene id: 5494

Gene Summary

• Gene Symbol: PPM1A   Gene   UCSC   Ensembl
• Aliases: PP2C-ALPHA, PP2CA, PP2Calpha
• Gene name: protein phosphatase, Mg2+/Mn2+ dependent 1A
• Alternate names: protein phosphatase 1A, protein phosphatase 1A (formerly 2C), magnesium-dependent, alpha isoform,
• Gene location: 14q23.1 (60245749: 60299086)     Exons: 17     NC_000014.9
• Gene summary(Entrez): The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase dephosphorylates, and negatively regulates the acti
• OMIM: 606108

Protein Summary

• Protein general information: P35813  
  • Name: Protein phosphatase 1A (EC 3.1.3.16) (Protein phosphatase 2C isoform alpha) (PP2C alpha) (Protein phosphatase IA)
  • Length: 382  
  • Mass: 42448
• Sequence:

  MGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLESWSFFAVYDGHAGSQVAKYCCEHL
  LDHITNNQDFKGSAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGL
  LCRNRKVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIE
  RSEEDDQFIILACDGIWDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGSRDNMSVILICFPNAPKVSPE
  AVKKEAELDKYLECRVEEIIKKQGEGVPDLVHVMRTLASENIPSLPPGGELASKRNVIEAVYNRLNPYKNDDTDS
  TSTDDMW

• Structural information:
  • Protein Domains: (23..29-)
    (/note="PPM-type-phosphatase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01082"-)
  • Interpro: IPR015655  IPR000222  IPR012911  IPR036580  IPR036457   IPR001932  
  • Prosite: PS01032 PS51746
  • CDD: cd00143
  • PDB: 1A6Q 3FXJ 3FXK 3FXL 3FXM 3FXO 4RA2 4RAF 4RAG 6B67
  • PDBsum: 1A6Q 3FXJ 3FXK 3FXL 3FXM 3FXO 4RA2 4RAF 4RAG 6B67
  • STRING: ENSP00000327255
• Other Databases: GeneCards:  PPM1A  Malacards:  PPM1A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004722	protein serine/threonine phosphatase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0090263	positive regulation of canonical Wnt signaling pathway	IBA	biological process
GO:0004724	magnesium-dependent protein serine/threonine phosphatase activity	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0043124	negative regulation of I-kappaB kinase/NF-kappaB signaling	IBA	biological process
GO:0043124	negative regulation of I-kappaB kinase/NF-kappaB signaling	IMP	biological process
GO:0006499	N-terminal protein myristoylation	ISS	biological process
GO:0006470	protein dephosphorylation	IMP	biological process
GO:0005829	cytosol	ISS	cellular component
GO:0070412	R-SMAD binding	IPI	molecular function
GO:1901223	negative regulation of NIK/NF-kappaB signaling	IMP	biological process
GO:0016020	membrane	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0000287	magnesium ion binding	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0030145	manganese ion binding	IEA	molecular function
GO:0043169	cation binding	IEA	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0004722	protein serine/threonine phosphatase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004722	protein serine/threonine phosphatase activity	TAS	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	TAS	biological process
GO:0004722	protein serine/threonine phosphatase activity	TAS	molecular function
GO:0004722	protein serine/threonine phosphatase activity	TAS	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0007050	cell cycle arrest	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071560	cellular response to transforming growth factor beta stimulus	IEA	biological process
GO:0046827	positive regulation of protein export from nucleus	IEA	biological process
GO:0006499	N-terminal protein myristoylation	IEA	biological process
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0030514	negative regulation of BMP signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016311	dephosphorylation	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0090263	positive regulation of canonical Wnt signaling pathway	IDA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0035970	peptidyl-threonine dephosphorylation	IDA	biological process
GO:0035970	peptidyl-threonine dephosphorylation	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0004722	protein serine/threonine phosphatase activity	IDA	molecular function
GO:0033192	calmodulin-dependent protein phosphatase activity	IDA	molecular function
GO:0030512	negative regulation of transforming growth factor beta receptor signaling pathway	IDA	biological process
GO:0010991	negative regulation of SMAD protein complex assembly	IDA	biological process
GO:0004722	protein serine/threonine phosphatase activity	IDA	molecular function
GO:0004722	protein serine/threonine phosphatase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	HMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04010	MAPK signaling pathway

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)