• Gene id: 54938

Gene Summary

• Gene Symbol: SARS2   Gene   UCSC   Ensembl
• Aliases: SARS, SARSM, SERS, SYS, SerRS, SerRSmt, mtSerRS
• Gene name: seryl-tRNA synthetase 2, mitochondrial
• Alternate names: serine--tRNA ligase, mitochondrial, mitochondrial seryl-tRNA synthetase, serine tRNA ligase 2, mitochondrial, seryl-tRNA synthetase, mitochondrial, seryl-tRNA(Ser/Sec) synthetase,
• Gene location: 19q13.2 (33599361: 33583659)     Exons: 8     NC_000002.12
• Gene summary(Entrez): This gene encodes the mitochondrial seryl-tRNA synthethase precursor, a member of the class II tRNA synthetase family. The mature enzyme catalyzes the ligation of Serine to tRNA(Ser) and participates in the biosynthesis of selenocysteinyl-tRNA(sec) in mit
• OMIM: 612804

Protein Summary

• Protein general information: Q9NP81  
  • Name: Serine tRNA ligase, mitochondrial (EC 6.1.1.11) (SerRSmt) (Seryl tRNA synthetase) (SerRS) (Seryl tRNA(Ser/Sec) synthetase)
  • Length: 518  
  • Mass: 58283
• Sequence:

  MAASMARRLWPLLTRRGFRPRGGCISNDSPRRSFTTEKRNRNLLYEYAREGYSALPQLDIERFCACPEEAAHALE
  LRKGELRSADLPAIISTWQELRQLQEQIRSLEEEKAAVTEAVRALLANQDSGEVQQDPKYQGLRARGREIRKELV
  HLYPREAQLEEQFYLQALKLPNQTHPDVPVGDESQARVLHMVGDKPVFSFQPRGHLEIGEKLDIIRQKRLSHVSG
  HRSYYLRGAGALLQHGLVNFTFNKLLRRGFTPMTVPDLLRGAVFEGCGMTPNANPSQIYNIDPARFKDLNLAGTA
  EVGLAGYFMDHTVAFRDLPVRMVCSSTCYRAETNTGQEPRGLYRVHHFTKVEMFGVTGPGLEQSSQLLEEFLSLQ
  MEILTELGLHFRVLDMPTQELGLPAYRKFDIEAWMPGRGRFGEVTSASNCTDFQSRRLHIMFQTEAGELQFAHTV
  NATACAVPRLLIALLESNQQKDGSVLVPPALQSYLGTDRITAPTHVPLQYIGPNQPRKPGLPGQPAVS

• Structural information:
  • Interpro: IPR002314  IPR006195  IPR002317  IPR042103  IPR033729   IPR010978  
  • Prosite: PS50862
  • CDD: cd00770
  • STRING: ENSP00000472847
• Other Databases: GeneCards:  SARS2  Malacards:  SARS2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070158	mitochondrial seryl-tRNA aminoacylation	IBA	biological process
GO:0000049	tRNA binding	IBA	molecular function
GO:0006434	seryl-tRNA aminoacylation	IBA	biological process
GO:0005739	mitochondrion	IBA	cellular component
GO:0004828	serine-tRNA ligase activity	IBA	molecular function
GO:0004812	aminoacyl-tRNA ligase activity	IEA	molecular function
GO:0006418	tRNA aminoacylation for protein translation	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004828	serine-tRNA ligase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006434	seryl-tRNA aminoacylation	IEA	biological process
GO:0004812	aminoacyl-tRNA ligase activity	IEA	molecular function
GO:0006412	translation	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0016874	ligase activity	IEA	molecular function
GO:0004828	serine-tRNA ligase activity	IEA	molecular function
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0006418	tRNA aminoacylation for protein translation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0097056	selenocysteinyl-tRNA(Sec) biosynthetic process	IEA	biological process
GO:0006434	seryl-tRNA aminoacylation	ISS	biological process
GO:0005739	mitochondrion	ISS	cellular component
GO:0004828	serine-tRNA ligase activity	ISS	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0005524	ATP binding	ISS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa00970	Aminoacyl-tRNA biosynthesis

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq