• Gene id: 54931

Gene Summary

• Gene Symbol: TRMT10C   Gene   UCSC   Ensembl
• Aliases: COXPD30, HNYA, MRPP1, RG9MTD1
• Gene name: tRNA methyltransferase 10C, mitochondrial RNase P subunit
• Alternate names: tRNA methyltransferase 10 homolog C, HBV pre-S2 trans-regulated protein 2, RNA (guanine-9-) methyltransferase domain containing 1, mRNA methyladenosine-N(1)-methyltransferase, mitochondrial RNase P subunit 1, mitochondrial ribonuclease P protein 1, renal carcin,
• Gene location: 3q12.3 (101561867: 101566445)     Exons: 2     NC_000003.12
• Gene summary(Entrez): This gene encodes the precursor of a subunit of the mitochondrial ribonuclease P, which is involved in 5' processing of mitochondrial tRNAs. The encoded protein may confer RNA-binding capacity to mitochondrial ribonuclease P and may be essential for trans
• OMIM: 615423

Protein Summary

• Protein general information: Q7L0Y3  
  • Name: tRNA methyltransferase 10 homolog C (HBV pre S2 trans regulated protein 2) (Mitochondrial ribonuclease P protein 1) (Mitochondrial RNase P protein 1) (RNA (guanine 9 ) methyltransferase domain containing protein 1) (Renal carcinoma antigen NY REN 49) (mRN
  • Length: 403  
  • Mass: 47347
• Sequence:

  MAAFLKMSVSVNFFRPFTRFLVPFTLHRKRNNLTILQRYMSSKIPAVTYPKNESTPPSEELELDKWKTTMKSSVQ
  EECVSTISSSKDEDPLAATREFIEMWRLLGREVPEHITEEELKTLMECVSNTAKKKYLKYLYTKEKVKKARQIKK
  EMKAAAREEAKNIKLLETTEEDKQKNFLFLRLWDRNMDIAMGWKGAQAMQFGQPLVFDMAYENYMKRKELQNTVS
  QLLESEGWNRRNVDPFHIYFCNLKIDGALHRELVKRYQEKWDKLLLTSTEKSHVDLFPKDSIIYLTADSPNVMTT
  FRHDKVYVIGSFVDKSMQPGTSLAKAKRLNLATECLPLDKYLQWEIGNKNLTLDQMIRILLCLKNNGNWQEALQF
  VPKRKHTGFLEISQHSQEFINRLKKAKT

• Structural information:
  • Protein Domains: (191..38-)
    TRM10-type (/note="SAM-dependent-MTase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01012"-)
  • Interpro: IPR028564  IPR038459  IPR025812  IPR007356  IPR016009  
  • Prosite: PS51675
  • PDB: 5NFJ
  • PDBsum: 5NFJ
  • STRING: ENSP00000312356
• Other Databases: GeneCards:  TRMT10C  Malacards:  TRMT10C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0090646	mitochondrial tRNA processing	IBA	biological process
GO:0030678	mitochondrial ribonuclease P complex	IBA	cellular component
GO:0009019	tRNA (guanine-N1-)-methyltransferase activity	IBA	molecular function
GO:0005654	nucleoplasm	IBA	cellular component
GO:0000049	tRNA binding	IBA	molecular function
GO:0005739	mitochondrion	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0061953	mRNA (adenine-N1-)-methyltransferase activity	IDA	molecular function
GO:0000049	tRNA binding	IDA	molecular function
GO:0097745	mitochondrial tRNA 5'-end processing	IDA	biological process
GO:0080009	mRNA methylation	IDA	biological process
GO:1990180	mitochondrial tRNA 3'-end processing	IDA	biological process
GO:0090646	mitochondrial tRNA processing	IMP	biological process
GO:0000964	mitochondrial RNA 5'-end processing	IMP	biological process
GO:0070131	positive regulation of mitochondrial translation	IMP	biological process
GO:0005739	mitochondrion	IMP	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0008033	tRNA processing	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0032259	methylation	IEA	biological process
GO:0008033	tRNA processing	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0042645	mitochondrial nucleoid	IEA	cellular component
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0052905	tRNA (guanine(9)-N(1))-methyltransferase activity	IEA	molecular function
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0070901	mitochondrial tRNA methylation	TAS	biological process
GO:0070901	mitochondrial tRNA methylation	TAS	biological process
GO:0090646	mitochondrial tRNA processing	TAS	biological process
GO:0090646	mitochondrial tRNA processing	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0042645	mitochondrial nucleoid	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0030678	mitochondrial ribonuclease P complex	TAS	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0016429	tRNA (adenine-N1-)-methyltransferase activity	IDA	molecular function
GO:0009019	tRNA (guanine-N1-)-methyltransferase activity	IDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Combined oxidative phosphorylation deficiency	KEGG:H00891
Combined oxidative phosphorylation deficiency	KEGG:H00891
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)