• Gene id: 54930

Gene Summary

• Gene Symbol: HAUS4   Gene   UCSC   Ensembl
• Aliases: C14orf94
• Gene name: HAUS augmin like complex subunit 4
• Alternate names: HAUS augmin-like complex subunit 4, homologous to Augmin subunits,
• Gene location: 14q11.2 (22957141: 22946227)     Exons: 10     NC_000014.9
• Gene summary(Entrez): This gene encodes a subunit of the centrosome complex termed the human augmin complex. The encoded protein localizes to the spindle microtubules and may play a role in mitotic spindle assembly and maintenance of centrosome integrity during cell division.
• OMIM: 613431

Protein Summary

• Protein general information: Q9H6D7  
  • Name: HAUS augmin like complex subunit 4
  • Length: 363  
  • Mass: 42400
• Sequence:

  MASGDFCSPGEGMEILQQVCSKQLPPCNLSKEDLLQNPYFSKLLLNLSQHVDESGLSLTLAKEQAQAWKEVRLHK
  TTWLRSEILHRVIQELLVDYYVKIQDTNVTSEDKKFHETLEQRLLVTELMRLLGPSQEREIPPLLGLEKADLLEL
  MPLSEDFVWMRARLQQEVEEQLKKKCFTLLCYYDPNSDADSETVKAAKVWKLAEVLVGEQQQCQDAKSQQKEQML
  LLEKKSAAYSQVLLRCLTLLQRLLQEHRLKTQSELDRINAQYLEVKCGAMILKLRMEELKILSDTYTVEKVEVHR
  LIRDRLEGAIHLQEQDMENSRQVLNSYEVLGEEFDRLVKEYTVLKQATENKRWALQEFSKVYR

• Structural information:
  • Interpro: IPR029327  IPR026214  
  • DIP: 48837
  • STRING: ENSP00000206474
• Other Databases: GeneCards:  HAUS4  Malacards:  HAUS4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070652	HAUS complex	IBA	cellular component
GO:0051225	spindle assembly	IBA	biological process
GO:0051011	microtubule minus-end binding	IBA	molecular function
GO:0007098	centrosome cycle	IBA	biological process
GO:0005813	centrosome	IDA	cellular component
GO:0007098	centrosome cycle	IEA	biological process
GO:0051225	spindle assembly	IEA	biological process
GO:0070652	HAUS complex	IEA	cellular component
GO:0051301	cell division	IEA	biological process
GO:0005874	microtubule	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0000086	G2/M transition of mitotic cell cycle	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0010389	regulation of G2/M transition of mitotic cell cycle	TAS	biological process
GO:0097711	ciliary basal body-plasma membrane docking	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005819	spindle	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0070652	HAUS complex	IDA	cellular component
GO:0070652	HAUS complex	IDA	cellular component
GO:0007098	centrosome cycle	IMP	biological process
GO:0051225	spindle assembly	IMP	biological process
GO:0051225	spindle assembly	IMP	biological process
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881