• Gene id: 54926

Gene Summary

• Gene Symbol: UBE2R2   Gene   UCSC   Ensembl
• Aliases: CDC34B, E2-CDC34B, UBC3B
• Gene name: ubiquitin conjugating enzyme E2 R2
• Alternate names: ubiquitin-conjugating enzyme E2 R2, E2 ubiquitin-conjugating enzyme R2, ubiquitin carrier protein R2, ubiquitin conjugating enzyme E2R 2, ubiquitin-conjugating enzyme E2-CDC34B, ubiquitin-conjugating enzyme UBC3B, ubiquitin-protein ligase R2,
• Gene location: 9p13.3 (33817159: 33920398)     Exons: 5     NC_000009.12
• Gene summary(Entrez): Protein kinase CK2 is a ubiquitous and pleiotropic Ser/Thr protein kinase involved in cell growth and transformation. This gene encodes a protein similar to the E2 ubiquitin conjugating enzyme UBC3/CDC34. Studies suggest that CK2-dependent phosphorylation
• OMIM: 612506

Protein Summary

• Protein general information: Q712K3  
  • Name: Ubiquitin conjugating enzyme E2 R2 (EC 2.3.2.23) (E2 ubiquitin conjugating enzyme R2) (Ubiquitin carrier protein R2) (Ubiquitin conjugating enzyme E2 CDC34B) (Ubiquitin protein ligase R2)
  • Length: 238  
  • Mass: 27166
• Sequence:

  MAQQQMTSSQKALMLELKSLQEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYFKAHIKFPIDYPYSPPTF
  RFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMFRK
  WRDSKGKDKEYAEIIRKQVSATKAEAEKDGVKVPTTLAEYCIKTKVPSNDNSSDLLYDDLYDDDIDDEDEEEEDA
  DCYDDDDSGNEES

• Structural information:
  • Interpro: IPR000608  IPR023313  IPR016135  
  • Prosite: PS00183 PS50127
  • CDD: cd00195
  • PDB: 6NYO
  • PDBsum: 6NYO
  • STRING: ENSP00000263228
• Other Databases: GeneCards:  UBE2R2  Malacards:  UBE2R2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016740	transferase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0061631	ubiquitin conjugating enzyme activity	IEA	molecular function
GO:0061631	ubiquitin conjugating enzyme activity	IDA	molecular function
GO:0016567	protein ubiquitination	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016567	protein ubiquitination	IEA	biological process
GO:0006513	protein monoubiquitination	IDA	biological process
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0070936	protein K48-linked ubiquitination	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04120	Ubiquitin mediated proteolysis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881