• Gene id: 54921

Gene Summary

• Gene Symbol: CHTF8   Gene   UCSC   Ensembl
• Aliases: CTF8, DERPC
• Gene name: chromosome transmission fidelity factor 8
• Alternate names: chromosome transmission fidelity protein 8 homolog, CTF8, chromosome transmission fidelity factor 8 homolog, decreased expression in renal and prostate cancer protein,
• Gene location: 16q22.1 (69132587: 69118009)     Exons: 5     NC_000016.10
• Gene summary(Entrez): This gene encodes a short protein that forms part of the Ctf18 replication factor C (RFC) complex that occurs in both yeast and mammals. The heteroheptameric RFC complex plays a role in sister chromatid cohesion and may load the replication clamp PCNA (pr
• OMIM: 613202

Protein Summary

• Protein general information: P0CG13  
  • Name: Chromosome transmission fidelity protein 8 homolog (hCTF8)
  • Length: 121  
  • Mass: 13314
• Sequence:

  MVQIVISSARAGGLAEWVLMELQGEIEARYSTGLAGNLLGDLHYTTEGIPVLIVGHHILYGKIIHLEKPFAVLVK
  HTPGDQDCDELGRETGTRYLVTALIKDKILFKTRPKPIITSVPKKV

• Structural information:
  • Interpro: IPR018607  
  • STRING: ENSP00000408367
• Other Databases: GeneCards:  CHTF8  Malacards:  CHTF8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006260	DNA replication	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0032508	DNA duplex unwinding	IEA	biological process
GO:0017116	single-stranded DNA helicase activity	IDA	contributes to
GO:1900264	positive regulation of DNA-directed DNA polymerase activity	IDA	biological process
GO:0003689	DNA clamp loader activity	IDA	contributes to
GO:0031390	Ctf18 RFC-like complex	IDA	cellular component
GO:0007064	mitotic sister chromatid cohesion	IEA	biological process
GO:0031390	Ctf18 RFC-like complex	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)