• Gene id: 54920

Gene Summary

• Gene Symbol: DUS2   Gene   UCSC   Ensembl
• Aliases: DUS2L, SMM1, URLC8
• Gene name: dihydrouridine synthase 2
• Alternate names: tRNA-dihydrouridine(20) synthase [NAD(P)+]-like, SMM1 homolog, dihydrouridine synthase 2-like, SMM1 homolog, tRNA-dihydrouridine(20) synthase (NAD(P)(+)), up-regulated in lung cancer protein 8,
• Gene location: 16q22.1 (68023283: 68079319)     Exons: 17     NC_000016.10
• Gene summary(Entrez): This gene encodes a cytoplasmic protein that catalyzes the conversion of uridine residues to dihydrouridine in the D-loop of tRNA. The resulting modified bases confer enhanced regional flexibility to tRNA. The encoded protein may increase the rate of tran
• OMIM: 609707

Protein Summary

• Protein general information: Q9NX74  
  • Name: tRNA dihydrouridine(20) synthase [NAD(P)+] like (EC 1.3.1.91) (Dihydrouridine synthase 2) (Up regulated in lung cancer protein 8) (URLC8) (tRNA dihydrouridine synthase 2 like) (hDUS2)
  • Length: 493  
  • Mass: 55050
  • Tissue specificity: Weak expression in heart, placenta and skeletal muscle. Up-regulated in most lung cancer cells (at protein level). {ECO
• Sequence:

  MILNSLSLCYHNKLILAPMVRVGTLPMRLLALDYGADIVYCEELIDLKMIQCKRVVNEVLSTVDFVAPDDRVVFR
  TCEREQNRVVFQMGTSDAERALAVARLVENDVAGIDVNMGCPKQYSTKGGMGAALLSDPDKIEKILSTLVKGTRR
  PVTCKIRILPSLEDTLSLVKRIERTGIAAIAVHGRKREERPQHPVSCEVIKAIADTLSIPVIANGGSHDHIQQYS
  DIEDFRQATAASSVMVARAAMWNPSIFLKEGLRPLEEVMQKYIRYAVQYDNHYTNTKYCLCQMLREQLESPQGRL
  LHAAQSSREICEAFGLGAFYEETTQELDAQQARLSAKTSEQTGEPAEDTSGVIKMAVKFDRRAYPAQITPKMCLL
  EWCRREKLAQPVYETVQRPLDRLFSSIVTVAEQKYQSTLWDKSKKLAEQAAAIVCLRSQGLPEGRLGEESPSLHK
  RKREAPDQDPGGPRAQELAQPGDLCKKPFVALGSGEESPLEGW

• Structural information:
  • Protein Domains: (369..43-)
    (/note="DRBM-)
    (/evidence="ECO:0000269|PubMed:26429968"-)
  • Interpro: IPR013785  IPR014720  IPR035587  IPR001269  IPR018517  
  • Prosite: PS01136
  • CDD: cd00048 cd02801
  • PDB: 4WFS 4WFT 4XP7 5OC4 5OC5 5OC6 6EI8 6EZA 6EZB 6EZC 6F00
  • PDBsum: 4WFS 4WFT 4XP7 5OC4 5OC5 5OC6 6EI8 6EZA 6EZB 6EZC 6F00
  • STRING: ENSP00000455229
• Other Databases: GeneCards:  DUS2  Malacards:  DUS2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0017150	tRNA dihydrouridine synthase activity	IBA	molecular function
GO:0002943	tRNA dihydrouridine synthesis	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0010181	FMN binding	IDA	molecular function
GO:0017150	tRNA dihydrouridine synthase activity	IDA	molecular function
GO:0002943	tRNA dihydrouridine synthesis	IDA	biological process
GO:0060548	negative regulation of cell death	IDA	biological process
GO:0070402	NADPH binding	IDA	molecular function
GO:0004860	protein kinase inhibitor activity	IDA	molecular function
GO:0003725	double-stranded RNA binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008033	tRNA processing	IEA	biological process
GO:0017150	tRNA dihydrouridine synthase activity	IEA	molecular function
GO:0050660	flavin adenine dinucleotide binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0003824	catalytic activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0008033	tRNA processing	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0102264	tRNA-dihydrouridine20 synthase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0006469	negative regulation of protein kinase activity	IEA	biological process

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R