• Gene id: 54915

Gene Summary

• Gene Symbol: YTHDF1   Gene   UCSC   Ensembl
• Aliases: C20orf21
• Gene name: YTH N6-methyladenosine RNA binding protein 1
• Alternate names: YTH domain-containing family protein 1, DACA-1, YTH N(6)-methyladenosine RNA binding protein 1, YTH domain family 1, YTH domain family protein 1, YTH domain family, member 1, dermatomyositis associated with cancer putative autoantigen 1,
• Gene location: 20q13.33 (218672048: 218702716)     Exons: 30     NC_000002.12
• OMIM: 616529

Protein Summary

• Protein general information: Q9BYJ9  
  • Name: YTH domain containing family protein 1 (Dermatomyositis associated with cancer putative autoantigen 1) (DACA 1)
  • Length: 559  
  • Mass: 60874
• Sequence:

  MSATSVDTQRTKGQDNKVQNGSLHQKDTVHDNDFEPYLTGQSNQSNSYPSMSDPYLSSYYPPSIGFPYSLNEAPW
  STAGDPPIPYLTTYGQLSNGDHHFMHDAVFGQPGGLGNNIYQHRFNFFPENPAFSAWGTSGSQGQQTQSSAYGSS
  YTYPPSSLGGTVVDGQPGFHSDTLSKAPGMNSLEQGMVGLKIGDVSSSAVKTVGSVVSSVALTGVLSGNGGTNVN
  MPVSKPTSWAAIASKPAKPQPKMKTKSGPVMGGGLPPPPIKHNMDIGTWDNKGPVPKAPVPQQAPSPQAAPQPQQ
  VAQPLPAQPPALAQPQYQSPQQPPQTRWVAPRNRNAAFGQSGGAGSDSNSPGNVQPNSAPSVESHPVLEKLKAAH
  SYNPKEFEWNLKSGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDSAFRCMSSKGPVYLLFSVNGSGHFCGVA
  EMKSPVDYGTSAGVWSQDKWKGKFDVQWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIISS
  YKHTTSIFDDFAHYEKRQEEEEVVRKERQSRNKQ

• Structural information:
  • Protein Domains: (389..52-)
    (/note="YTH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00225"-)
  • Interpro: IPR007275  
  • Prosite: PS50882
  • PDB: 4RCI 4RCJ
  • PDBsum: 4RCI 4RCJ
  • STRING: ENSP00000359364
• Other Databases: GeneCards:  YTHDF1  Malacards:  YTHDF1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1990247	N6-methyladenosine-containing RNA binding	IBA	molecular function
GO:0003729	mRNA binding	IBA	molecular function
GO:0061157	mRNA destabilization	IBA	biological process
GO:0045948	positive regulation of translational initiation	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:1990247	N6-methyladenosine-containing RNA binding	IDA	molecular function
GO:0043022	ribosome binding	IDA	molecular function
GO:1990247	N6-methyladenosine-containing RNA binding	IDA	molecular function
GO:0045948	positive regulation of translational initiation	IDA	biological process
GO:1990247	N6-methyladenosine-containing RNA binding	IDA	molecular function
GO:1990247	N6-methyladenosine-containing RNA binding	IDA	molecular function
GO:1990247	N6-methyladenosine-containing RNA binding	IDA	molecular function
GO:0045727	positive regulation of translation	IMP	biological process
GO:0045727	positive regulation of translation	IMP	biological process
GO:1902667	regulation of axon guidance	ISS	biological process
GO:1900271	regulation of long-term synaptic potentiation	ISS	biological process
GO:0007613	memory	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0007612	learning	ISS	biological process
GO:0002577	regulation of antigen processing and presentation	ISS	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007613	memory	IEA	biological process
GO:0045727	positive regulation of translation	IEA	biological process
GO:1900271	regulation of long-term synaptic potentiation	IEA	biological process
GO:1902667	regulation of axon guidance	IEA	biological process
GO:1990247	N6-methyladenosine-containing RNA binding	IEA	molecular function
GO:0002577	regulation of antigen processing and presentation	IEA	biological process
GO:0007612	learning	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray