• Gene id: 54905

Gene Summary

• Gene Symbol: CYP2W1   Gene   UCSC   Ensembl
• Gene name: cytochrome P450 family 2 subfamily W member 1
• Alternate names: cytochrome P450 2W1, CYPIIW1, cytochrome P450, family 2, subfamily W, polypeptide 1,
• Gene location: 7p22.3 (983154: 989639)     Exons: 10     NC_000007.14
• Gene summary(Entrez): This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. [provided by RefSe

Protein Summary

• Protein general information: Q8TAV3  
  • Name: Cytochrome P450 2W1 (EC 1.14.14. ) (CYPIIW1)
  • Length: 490  
  • Mass: 53844
  • Tissue specificity: Very low levels are detected in fetal and adult tissues. Highly expressed in several tumor samples, in particular colon and adrenal tumors. {ECO
• Sequence:

  MALLLLLFLGLLGLWGLLCACAQDPSPAARWPPGPRPLPLVGNLHLLRLSQQDRSLMELSERYGPVFTVHLGRQK
  TVVLTGFEAVKEALAGPGQELADRPPIAIFQLIQRGGGIFFSSGARWRAARQFTVRALHSLGVGREPVADKILQE
  LKCLSGQLDGYRGRPFPLALLGWAPSNITFALLFGRRFDYRDPVFVSLLGLIDEVMVLLGSPGLQLFNVYPWLGA
  LLQLHRPVLRKIEEVRAILRTLLEARRPHVCPGDPVCSYVDALIQQGQGDDPEGLFAEANAVACTLDMVMAGTET
  TSATLQWAALLMGRHPDVQGRVQEELDRVLGPGRTPRLEDQQALPYTSAVLHEVQRFITLLPHVPRCTAADTQLG
  GFLLPKGTPVIPLLTSVLLDETQWQTPGQFNPGHFLDANGHFVKREAFLPFSAGRRVCVGERLARTELFLLFAGL
  LQRYRLLPPPGVSPASLDTTPARAFTMRPRAQALCAVPRP

• Structural information:
  • Interpro: IPR001128  IPR017972  IPR002401  IPR036396  
  • Prosite: PS00086
  • STRING: ENSP00000310149
• Other Databases: GeneCards:  CYP2W1  Malacards:  CYP2W1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005506	iron ion binding	IEA	molecular function
GO:0020037	heme binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016705	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen	IEA	molecular function
GO:0055114	oxidation-reduction process	IBA	biological process
GO:0043231	intracellular membrane-bounded organelle	IBA	cellular component
GO:0020037	heme binding	IBA	molecular function
GO:0016712	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen	IBA	molecular function
GO:0006805	xenobiotic metabolic process	IBA	biological process
GO:0006082	organic acid metabolic process	IBA	biological process
GO:0042738	exogenous drug catabolic process	IBA	biological process
GO:0008395	steroid hydroxylase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0004497	monooxygenase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	IEA	cellular component
GO:0031090	organelle membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0046222	aflatoxin metabolic process	IDA	biological process
GO:0005788	endoplasmic reticulum lumen	IDA	cellular component
GO:0006805	xenobiotic metabolic process	IDA	biological process
GO:0006644	phospholipid metabolic process	IDA	biological process
GO:1904768	all-trans-retinol binding	IDA	molecular function
GO:0005503	all-trans retinal binding	IDA	molecular function
GO:0008401	retinoic acid 4-hydroxylase activity	IDA	molecular function
GO:0009986	cell surface	IDA	cellular component
GO:0001972	retinoic acid binding	IDA	molecular function
GO:0034653	retinoic acid catabolic process	IDA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq