• Gene id: 54900

Gene Summary

• Gene Symbol: LAX1   Gene   UCSC   Ensembl
• Aliases: LAX
• Gene name: lymphocyte transmembrane adaptor 1
• Alternate names: lymphocyte transmembrane adapter 1, LAT-like membrane associated protein, linker for activation of x cells, membrane-associated adapter protein LAX,
• Gene location: 1q32.1 (203765131: 203778174)     Exons: 6     NC_000001.11
• OMIM: 611290

Protein Summary

• Protein general information: Q8IWV1  
  • Name: Lymphocyte transmembrane adapter 1 (Linker for activation of X cells) (Membrane associated adapter protein LAX)
  • Length: 398  
  • Mass: 44085
  • Tissue specificity: Expressed in spleen, thymus, and peripheral blood leukocytes. Expressed in several B-, T-, NK and monocyte cell lines. {ECO
• Sequence:

  MDGVTPTLSTIRGRTLESSTLHVTPRSLDRNKDQITNIFSGFAGLLAILLVVAVFCILWNWNKRKKRQVPYLRVT
  VMPLLTLPQTRQRAKNIYDILPWRQEDLGRHESRSMRIFSTESLLSRNSESPEHVPSQAGNAFQEHTAHIHATEY
  AVGIYDNAMVPQMCGNLTPSAHCINVRASRDCASISSEDSHDYVNVPTAEEIAETLASTKSPSRNLFVLPSTQKL
  EFTEERDEGCGDAGDCTSLYSPGAEDSDSLSNGEGSSQISNDYVNMTGLDLSAIQERQLWVAFQCCRDYENVPAA
  DPSGSQQQAEKDVPSSNIGHVEDKTDDPGTHVQCVKRTFLASGDYADFQPFTQSEDSQMKHREEMSNEDSSDYEN
  VLTAKLGGRDSEQGPGTQLLPDE

• Structural information:
  • Interpro: IPR031393  
  • STRING: ENSP00000406970
• Other Databases: GeneCards:  LAX1  Malacards:  LAX1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006955	immune response	IDA	biological process
GO:0019901	protein kinase binding	IDA	molecular function
GO:0035556	intracellular signal transduction	IDA	biological process
GO:0042169	SH2 domain binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045121	membrane raft	IDA	NOT|cellular component
GO:0016021	integral component of membrane	IDA	cellular component
GO:0050868	negative regulation of T cell activation	IDA	biological process
GO:0042113	B cell activation	IDA	biological process
GO:0000188	inactivation of MAPK activity	IMP	biological process
GO:0050851	antigen receptor-mediated signaling pathway	IBA	biological process
GO:0050868	negative regulation of T cell activation	IBA	biological process
GO:0046649	lymphocyte activation	IBA	biological process
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0006955	immune response	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0051249	regulation of lymphocyte activation	IEA	biological process
GO:0006955	immune response	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0002250	adaptive immune response	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016020	membrane	HDA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R