• Gene id: 54899

Gene Summary

• Gene Symbol: PXK   Gene   UCSC   Ensembl
• Aliases: MONAKA, SLOB
• Gene name: PX domain containing serine/threonine kinase like
• Alternate names: PX domain-containing protein kinase-like protein, PX ser/thr kinase v2, PX serine/threonine kinase, modulator of Na,K-ATPase long form,
• Gene location: 3p14.3 (58332889: 58426126)     Exons: 7     NC_000003.12
• Gene summary(Entrez): This gene encodes a phox (PX) domain-containing protein which may be involved in synaptic transmission and the ligand-induced internalization and degradation of epidermal growth factors. Variations in this gene may be associated with susceptibility to sys
• OMIM: 611450

Protein Summary

• Protein general information: Q7Z7A4  
  • Name: PX domain containing protein kinase like protein (Modulator of Na,K ATPase) (MONaKA)
  • Length: 578  
  • Mass: 64950
  • Tissue specificity: Widely expressed in all tissues examined except in heart. Isoform 1 is expressed in high levels in the brain, skeletal muscle, spleen and testis. Isoform 7 expression has yet to be demonstrated. {ECO
• Sequence:

  MAFMEKPPAGKVLLDDTVPLTAAIEASQSLQSHTEYIIRVQRGISVENSWQIVRRYSDFDLLNNSLQIAGLSLPL
  PPKKLIGNMDREFIAERQKGLQNYLNVITTNHILSNCELVKKFLDPNNYSANYTEIALQQVSMFFRSEPKWEVVE
  PLKDIGWRIRKKYFLMKIKNQPKERLVLSWADLGPDKYLSDKDFQCLIKLLPSCLHPYIYRVTFATANESSALLI
  RMFNEKGTLKDLIYKAKPKDPFLKKYCNPKKIQGLELQQIKTYGRQILEVLKFLHDKGFPYGHLHASNVMLDGDT
  CRLLDLENSLLGLPSFYRSYFSQFRKINTLESVDVHCFGHLLYEMTYGRPPDSVPVDSFPPAPSMAVVAVLESTL
  SCEACKNGMPTISRLLQMPLFSDVLLTTSEKPQFKIPTKLKEALRIAKECIEKRLIEEQKQIHQHRRLTRAQSHH
  GSEEERKKRKILARKKSKRSALENSEEHSAKYSNSNNSAGSGASSPLTSPSSPTPPSTSGISALPPPPPPPPPPA
  APLPPASTEAPAQLSSQAVNGMSRGALLSSIQNFQKGTLRKAKTCDHSAPKIG

• Structural information:
  • Protein Domains: (14..12-)
    (/note="PX-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00147-)
    (88..48-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159-)
    (548..56-)
    (/note="WH2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00406"-)
  • Interpro: IPR011009  IPR037903  IPR001683  IPR000719  IPR036871   IPR003124  
  • Prosite: PS50011 PS50195 PS51082
  • CDD: cd06871
  • STRING: ENSP00000348472
• Other Databases: GeneCards:  PXK  Malacards:  PXK

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032780	negative regulation of ATPase activity	IBA	biological process
GO:0043271	negative regulation of ion transport	IBA	biological process
GO:0042391	regulation of membrane potential	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0003779	actin binding	IEA	molecular function
GO:0035091	phosphatidylinositol binding	IEA	molecular function
GO:0003779	actin binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0032991	protein-containing complex	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0050804	modulation of chemical synaptic transmission	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0034451	centriolar satellite	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0006468	protein phosphorylation	IEA	biological process
GO:0006468	protein phosphorylation	NAS	NOT|biological process
GO:0005886	plasma membrane	ISS	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0004672	protein kinase activity	NAS	NOT|molecular function
GO:0050804	modulation of chemical synaptic transmission	ISS	biological process
GO:0006954	inflammatory response	IMP	biological process
GO:0005524	ATP binding	NAS	NOT|molecular function
GO:0000166	nucleotide binding	NAS	NOT|molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881