• Gene id: 54892

Gene Summary

• Gene Symbol: NCAPG2   Gene   UCSC   Ensembl
• Aliases: 3KS, CAP-G2, CAPG2, LUZP5, MTB, hCAP-G2
• Gene name: non-SMC condensin II complex subunit G2
• Alternate names: condensin-2 complex subunit G2, chromosome-associated protein G2, leucine zipper protein 5, more than blood homolog,
• Gene location: 7q36.3 (158704815: 158631168)     Exons: 33     NC_000007.14
• Gene summary(Entrez): This gene encodes a protein that belongs to the Condensin2nSMC family of proteins. The encoded protein is a regulatory subunit of the condensin II complex which, along with the condensin I complex, plays a role in chromosome assembly and segregation durin
• OMIM: 609623

Protein Summary

• Protein general information: Q86XI2  
  • Name: Condensin 2 complex subunit G2 (Chromosome associated protein G2) (CAP G2) (hCAP G2) (Leucine zipper protein 5) (Non SMC condensin II complex subunit G2)
  • Length: 1143  
  • Mass: 130960
• Sequence:

  MEKRETFVQAVSKELVGEFLQFVQLDKEASDPFSLNELLDELSRKQKEELWQRLKNLLTDVLLESPVDGWQVVEA
  QGEDNMETEHGSKMRKSIEIIYAITSVILASVSVINESENYEALLECVIILNGILYALPESERKLQSSIQDLCVT
  WWEKGLPAKEDTGKTAFVMLLRRSLETKTGADVCRLWRIHQALYCFDYDLEESGEIKDMLLECFININYIKKEEG
  RRFLSCLFNWNINFIKMIHGTIKNQLQGLQKSLMVYIAEIYFRAWKKASGKILEAIENDCIQDFMFHGIHLPRRS
  PVHSKVREVLSYFHHQKKVRQGVEEMLYRLYKPILWRGLKARNSEVRSNAALLFVEAFPIRDPNLHAIEMDSEIQ
  KQFEELYSLLEDPYPMVRSTGILGVCKITSKYWEMMPPTILIDLLKKVTGELAFDTSSADVRCSVFKCLPMILDN
  KLSHPLLEQLLPALRYSLHDNSEKVRVAFVDMLLKIKAVRAAKFWKICPMEHILVRLETDSRPVSRRLVSLIFNS
  FLPVNQPEEVWCERCVTLVQMNHAAARRFYQYAHEHTACTNIAKLIHVIRHCLNACIQRAVREPPEDEEEEDGRE
  KENVTVLDKTLSVNDVACMAGLLEIIVILWKSIDRSMENNKEAKLYTINKFASVLPEYLKVFKDDRCKIPLFMLM
  SFMPASAVPPFSCGVISTLRSREEGAVDKSYCTLLDCLCSWGQVGHILELVDNWLPTEHAQAKSNTASKGRVQIH
  DTRPVKPELALVYIEYLLTHPKNRECLLSAPRKKLNHLLKALETSKADLESLLQTPGGKPRGFSEAAAPRAFGLH
  CRLSIHLQHKFCSEGKVYLSMLEDTGFWLESKILSFIQDQEEDYLKLHRVIYQQIIQTYLTVCKDVVMVGLGDHQ
  FQMQLLQRSLGIMQTVKGFFYVSLLLDILKEITGSSLIQKTDSDEEVAMLLDTVQKVFQKMLECIARSFRKQPEE
  GLRLLYSVQRPLHEFITAVQSRHTDTPVHRGVLSTLIAGPVVEISHQLRKVSDVEELTPPEHLSDLPPFSRCLIG
  IIIKSSNVVRSFLDELKACVASNDIEGIVCLTAAVHIILVINAGKHKSSKVREVAATVHRKLKTFMEITLEEDSI
  ERFLYESSSRTLGELLNS

• Structural information:
  • Interpro: IPR011989  IPR016024  IPR024741  
  • DIP: 43902
  • STRING: ENSP00000387007
• Other Databases: GeneCards:  NCAPG2  Malacards:  NCAPG2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000796	condensin complex	IBA	cellular component
GO:0000070	mitotic sister chromatid segregation	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0035064	methylated histone binding	IDA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0030261	chromosome condensation	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0043425	bHLH transcription factor binding	IEA	molecular function
GO:0030218	erythrocyte differentiation	IEA	biological process
GO:0006366	transcription by RNA polymerase II	IEA	biological process
GO:0000796	condensin complex	IEA	cellular component
GO:2000273	positive regulation of signaling receptor activity	IEA	biological process
GO:0140416	DNA-binding transcription factor inhibitor activity	IEA	molecular function
GO:0061098	positive regulation of protein tyrosine kinase activity	IEA	biological process
GO:0045647	negative regulation of erythrocyte differentiation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0001833	inner cell mass cell proliferation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0016020	membrane	HDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq