• Gene id: 54886

Gene Summary

• Gene Symbol: PLPPR1   Gene   UCSC   Ensembl
• Aliases: LPPR1, PRG-3
• Gene name: phospholipid phosphatase related 1
• Alternate names: phospholipid phosphatase-related protein type 1, lipid phosphate phosphatase-related protein type 1, plasticity related gene 3, plasticity-related gene 3 protein,
• Gene location: 9q31.1 (101028726: 101325134)     Exons: 9     NC_000009.12
• Gene summary(Entrez): This gene encodes a member of the plasticity-related gene (PRG) family. Members of the PRG family mediate lipid phosphate phosphatase activity in neurons and are known to be involved in neuronal plasticity. The protein encoded by this gene does not perfor
• OMIM: 185490

Protein Summary

• Protein general information: Q8TBJ4  
  • Name: Phospholipid phosphatase related protein type 1 (Lipid phosphate phosphatase related protein type 1) (Plasticity related gene 3 protein) (PRG 3)
  • Length: 325  
  • Mass: 35795
• Sequence:

  MAVGNNTQRSYSIIPCFIFVELVIMAGTVLLAYYFECTDTFQVHIQGFFCQDGDLMKPYPGTEEESFITPLVLYC
  VLAATPTAIIFIGEISMYFIKSTRESLIAQEKTILTGECCYLNPLLRRIIRFTGVFAFGLFATDIFVNAGQVVTG
  HLTPYFLTVCKPNYTSADCQAHHQFINNGNICTGDLEVIEKARRSFPSKHAALSIYSALYATMYITSTIKTKSSR
  LAKPVLCLGTLCTAFLTGLNRVSEYRNHCSDVIAGFILGTAVALFLGMCVVHNFKGTQGSPSKPKPEDPRGVPLM
  AFPRIESPLETLSAQNHSASMTEVT

• Structural information:
  • Interpro: IPR028678  IPR036938  IPR000326  
  • STRING: ENSP00000364008
• Other Databases: GeneCards:  PLPPR1  Malacards:  PLPPR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006644	phospholipid metabolic process	IBA	biological process
GO:0007165	signal transduction	IBA	biological process
GO:0008195	phosphatidate phosphatase activity	IBA	molecular function
GO:0042577	lipid phosphatase activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0016791	phosphatase activity	IBA	molecular function
GO:0046839	phospholipid dephosphorylation	IBA	biological process
GO:0006644	phospholipid metabolic process	IEA	biological process
GO:0008195	phosphatidate phosphatase activity	IEA	molecular function
GO:0007399	nervous system development	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881