• Gene id: 54884

Gene Summary

• Gene Symbol: RETSAT   Gene   UCSC   Ensembl
• Gene name: retinol saturase
• Alternate names: all-trans-retinol 13,14-reductase, PPAR-alpha-regulated and starvation-induced gene protein, all-trans-13,14-dihydroretinol saturase,
• Gene location: 2p11.2 (85354527: 85341954)     Exons: 11     NC_000002.12
• OMIM: 603945

Protein Summary

• Protein general information: Q6NUM9  
  • Name: All trans retinol 13,14 reductase (EC 1.3.99.23) (All trans 13,14 dihydroretinol saturase) (RetSat) (PPAR alpha regulated and starvation induced gene protein)
  • Length: 610  
  • Mass: 66820
  • Tissue specificity: Expressed in liver; expression positively correlates with obesity and liver steatosis (PubMed
• Sequence:

  MWLPLVLLLAVLLLAVLCKVYLGLFSGSSPNPFSEDVKRPPAPLVTDKEARKKVLKQAFSANQVPEKLDVVVIGS
  GFGGLAAAAILAKAGKRVLVLEQHTKAGGCCHTFGKNGLEFDTGIHYIGRMEEGSIGRFILDQITEGQLDWAPLS
  SPFDIMVLEGPNGRKEYPMYSGEKAYIQGLKEKFPQEEAIIDKYIKLVKVVSSGAPHAILLKFLPLPVVQLLDRC
  GLLTRFSPFLQASTQSLAEVLQQLGASSELQAVLSYIFPTYGVTPNHSAFSMHALLVNHYMKGGFYPRGGSSEIA
  FHTIPVIQRAGGAVLTKATVQSVLLDSAGKACGVSVKKGHELVNIYCPIVVSNAGLFNTYEHLLPGNARCLPGVK
  QQLGTVRPGLGMTSVFICLRGTKEDLHLPSTNYYVYYDTDMDQAMERYVSMPREEAAEHIPLLFFAFPSAKDPTW
  EDRFPGRSTMIMLIPTAYEWFEEWQAELKGKRGSDYETFKNSFVEASMSVVLKLFPQLEGKVESVTAGSPLTNQF
  YLAAPRGACYGADHDLGRLHPCVMASLRAQSPIPNLYLTGQDIFTCGLVGALQGALLCSSAILKRNLYSDLKNLD
  SRIRAQKKKN

• Structural information:
  • Interpro: IPR036188  
  • STRING: ENSP00000295802
• Other Databases: GeneCards:  RETSAT  Malacards:  RETSAT

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016491	oxidoreductase activity	ISS	molecular function
GO:0042572	retinol metabolic process	ISS	biological process
GO:0005789	endoplasmic reticulum membrane	ISS	cellular component
GO:0051786	all-trans-retinol 13,14-reductase activity	ISS	molecular function
GO:0005640	nuclear outer membrane	ISS	cellular component
GO:0055114	oxidation-reduction process	ISS	biological process
GO:0031965	nuclear membrane	ISS	cellular component
GO:0005789	endoplasmic reticulum membrane	IBA	cellular component
GO:0042572	retinol metabolic process	IBA	biological process
GO:0051786	all-trans-retinol 13,14-reductase activity	IBA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0051786	all-trans-retinol 13,14-reductase activity	IEA	molecular function
GO:0005640	nuclear outer membrane	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0031965	nuclear membrane	IEA	cellular component
GO:0051786	all-trans-retinol 13,14-reductase activity	IEA	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0042572	retinol metabolic process	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa00830	Retinol metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881