• Gene id: 54876

Gene Summary

• Gene Symbol: DCAF16   Gene   UCSC   Ensembl
• Aliases: C4orf30
• Gene name: DDB1 and CUL4 associated factor 16
• Alternate names: DDB1- and CUL4-associated factor 16,
• Gene location: 4p15.31 (20955486: 20956435)     Exons: 2     NC_000014.9

Protein Summary

• Protein general information: Q9NXF7  
  • Name: DDB1 and CUL4 associated factor 16
  • Length: 216  
  • Mass: 24193
• Sequence:

  MGPRNPSPDHLSESESEEEENISYLNESSGEEWDSSEEEDSMVPNLSPLESLAWQVKCLLKYSTTWKPLNPNSWL
  YHAKLLDPSTPVHILREIGLRLSHCSHCVPKLEPIPEWPPLASCGVPPFQKPLTSPSRLSRDHATLNGALQFATK
  QLSRTLSRATPIPEYLKQIPNSCVSGCCCGWLTKTVKETTRTEPINTTYSYTDFQKAVNKLLTASL

• Structural information:
  • Interpro: IPR028216  
  • STRING: ENSP00000371682
• Other Databases: GeneCards:  DCAF16  Malacards:  DCAF16

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0080008	Cul4-RING E3 ubiquitin ligase complex	IBA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0080008	Cul4-RING E3 ubiquitin ligase complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881