• Gene id: 54860

Gene Summary

• Gene Symbol: MS4A12   Gene   UCSC   Ensembl
• Aliases: Ms4a10
• Gene name: membrane spanning 4-domains A12
• Alternate names: membrane-spanning 4-domains subfamily A member 12,
• Gene location: 11q12.2 (60492742: 60507429)     Exons: 8     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene is a cell surface protein found primarily in the apical membrane of colonocytes. Silencing of this gene in colon cancer cells inhibits the proliferation, cell motility, and chemotactic invasion of cells. This gene is part
• OMIM: 606550

Protein Summary

• Protein general information: Q9NXJ0  
  • Name: Membrane spanning 4 domains subfamily A member 12
  • Length: 267  
  • Mass: 28069
• Sequence:

  MMSSKPTSHAEVNETIPNPYPPSSFMAPGFQQPLGSINLENQAQGAQRAQPYGITSPGIFASSQPGQGNIQMINP
  SVGTAVMNFKEEAKALGVIQIMVGLMHIGFGIVLCLISFSFREVLGFASTAVIGGYPFWGGLSFIISGSLSVSAS
  KELSRCLVKGSLGMNIVSSILAFIGVILLLVDMCINGVAGQDYWAVLSGKGISATLMIFSLLEFFVACATAHFAN
  QANTTTNMSVLVIPNMYESNPVTPASSSAPPRCNNYSANAPK

• Structural information:
  • Interpro: IPR007237  IPR030417  
  • STRING: ENSP00000016913
• Other Databases: GeneCards:  MS4A12  Malacards:  MS4A12

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)