• Gene id: 54855

Gene Summary

• Gene Symbol: TENT5C   Gene   UCSC   Ensembl
• Aliases: FAM46C
• Gene name: terminal nucleotidyltransferase 5C
• Alternate names: terminal nucleotidyltransferase 5C, family with sequence similarity 46 member C, non-canonical poly(A) polymerase FAM46C, protein FAM46C, putative nucleotidyltransferase FAM46C,
• Gene location: 1p12 (117606047: 117628388)     Exons: 2     NC_000001.11
• OMIM: 613952

Protein Summary

• Protein general information: Q5VWP2  
  • Name: Terminal nucleotidyltransferase 5C (EC 2.7.7.19) (Non canonical poly(A) polymerase FAM46C)
  • Length: 391  
  • Mass: 44944
• Sequence:

  MAEESSCTRDCMSFSVLNWDQVSRLHEVLTEVVPIHGRGNFPTLEITLKDIVQTVRSRLEEAGIKVHDVRLNGSA
  AGHVLVKDNGLGCKDLDLIFHVALPTEAEFQLVRDVVLCSLLNFLPEGVNKLKISPVTLKEAYVQKLVKVCTDTD
  RWSLISLSNKNGKNVELKFVDSIRRQFEFSVDSFQIILDSLLFFYDCSNNPISEHFHPTVIGESMYGDFEEAFDH
  LQNRLIATKNPEEIRGGGLLKYSNLLVRDFRPTDQEEIKTLERYMCSRFFIDFPDILEQQRKLETYLQNHFAEEE
  RSKYDYLMILRRVVNESTVCLMGHERRQTLNLISLLALRVLAEQNIIPSATNVTCYYQPAPYVSDGNFSNYYVAH
  PPVTYSQPYPTWLPCN

• Structural information:
  • Interpro: IPR012937  
  • STRING: ENSP00000358458
• Other Databases: GeneCards:  TENT5C  Malacards:  TENT5C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0048255	mRNA stabilization	IBA	biological process
GO:1990817	RNA adenylyltransferase activity	IBA	molecular function
GO:1990817	RNA adenylyltransferase activity	IDA	molecular function
GO:0048255	mRNA stabilization	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:1990817	RNA adenylyltransferase activity	IEA	molecular function
GO:0016779	nucleotidyltransferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0004652	polynucleotide adenylyltransferase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1990817	RNA adenylyltransferase activity	IEA	molecular function
GO:0048255	mRNA stabilization	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0001701	in utero embryonic development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray