• Gene id: 54852

Gene Summary

• Gene Symbol: PAQR5   Gene   UCSC   Ensembl
• Aliases: MPRG
• Gene name: progestin and adipoQ receptor family member 5
• Alternate names: membrane progestin receptor gamma, mPR gamma, membrane progesterone P4 receptor gamma, membrane progesterone receptor gamma, progesterone and adipoQ receptor family member 5, progestin and adipoQ receptor family member V,
• Gene location: 15q23 (69284133: 69407779)     Exons: 18     NC_000015.10
• OMIM: 602895

Protein Summary

• Protein general information: Q9NXK6  
  • Name: Membrane progestin receptor gamma (mPR gamma) (Membrane progesterone P4 receptor gamma) (Membrane progesterone receptor gamma) (Progesterone and adipoQ receptor family member 5) (Progestin and adipoQ receptor family member 5) (Progestin and adipoQ recepto
  • Length: 330  
  • Mass: 38014
  • Tissue specificity: Expressed in the brain, lung, kidney, colon, adrenal and lung. {ECO
• Sequence:

  MLSLKLPRLFSIDQIPQVFHEQGILFGYRHPQSSATACILSLFQMTNETLNIWTHLLPFWFFAWRFVTALYMTDI
  KNDSYSWPMLVYMCTSCVYPLVSSCAHTFSSMSKNARHICYFLDYGAVNLFSLGSAIAYSAYTFPDALMCTTFHD
  YYVALAVLNTILSTGLSCYSRFLEIQKPRLCKVIRVLAFAYPYTWDSLPIFYRLFLFPGESAQNEATSYHQKHMI
  MTLLASFLYSAHLPERLAPGRFDYIGHSHQLFHVCVILATHMQMEAILLDKTLRKEWLLATSKPFSFSQIAGAIL
  LCIIFSLSNIIYFSAALYRIPKPELHKKET

• Structural information:
  • Interpro: IPR004254  
  • STRING: ENSP00000378803
• Other Databases: GeneCards:  PAQR5  Malacards:  PAQR5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0038023	signaling receptor activity	IBA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0030154	cell differentiation	IEA	biological process
GO:0048477	oogenesis	IEA	biological process
GO:0008289	lipid binding	IEA	molecular function
GO:0005496	steroid binding	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq