• Gene id: 54847

Gene Summary

• Gene Symbol: SIDT1   Gene   UCSC   Ensembl
• Aliases: SID-1, SID1
• Gene name: SID1 transmembrane family member 1
• Alternate names: SID1 transmembrane family member 1,
• Gene location: 3q13.2 (113532295: 113629578)     Exons: 29     NC_000003.12
• Gene summary(Entrez): The protein encoded by this gene belongs to SID1 family of transmembrane dsRNA-gated channels. Family members transport dsRNA into cells and are required for systemic RNA interference. [provided by RefSeq, May 2017]

Protein Summary

• Protein general information: Q9NXL6  
  • Name: SID1 transmembrane family member 1
  • Length: 827  
  • Mass: 93839
• Sequence:

  MRGCLRLALLCALPWLLLAASPGHPAKSPRQPPAPRRDPFDAARGADFDHVYSGVVNLSTENIYSFNYTSQPDQV
  TAVRVYVNSSSENLNYPVLVVVRQQKEVLSWQVPLLFQGLYQRSYNYQEVSRTLCPSEATNETGPLQQLIFVDVA
  SMAPLGAQYKLLVTKLKHFQLRTNVAFHFTASPSQPQYFLYKFPKDVDSVIIKVVSEMAYPCSVVSVQNIMCPVY
  DLDHNVEFNGVYQSMTKKAAITLQKKDFPGEQFFVVFVIKPEDYACGGSFFIQEKENQTWNLQRKKNLEVTIVPS
  IKESVYVKSSLFSVFIFLSFYLGCLLVGFVHYLRFQRKSIDGSFGSNDGSGNMVASHPIAASTPEGSNYGTIDES
  SSSPGRQMSSSDGGPPGQSDTDSSVEESDFDTMPDIESDKNIIRTKMFLYLSDLSRKDRRIVSKKYKIYFWNIIT
  IAVFYALPVIQLVITYQTVVNVTGNQDICYYNFLCAHPLGVLSAFNNILSNLGHVLLGFLFLLIVLRRDILHRRA
  LEAKDIFAVEYGIPKHFGLFYAMGIALMMEGVLSACYHVCPNYSNFQFDTSFMYMIAGLCMLKLYQTRHPDINAS
  AYSAYASFAVVIMVTVLGVVFGKNDVWFWVIFSAIHVLASLALSTQIYYMGRFKIDLGIFRRAAMVFYTDCIQQC
  SRPLYMDRMVLLVVGNLVNWSFALFGLIYRPRDFASYMLGIFICNLLLYLAFYIIMKLRSSEKVLPVPLFCIVAT
  AVMWAAALYFFFQNLSSWEGTPAESREKNRECILLDFFDDHDIWHFLSATALFFSFLVLLTLDDDLDVVRRDQIP
  VF

• Structural information:
  • Interpro: IPR025958  
  • STRING: ENSP00000264852
• Other Databases: GeneCards:  SIDT1  Malacards:  SIDT1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005764	lysosome	IBA	cellular component
GO:0051033	RNA transmembrane transporter activity	IBA	molecular function
GO:0050658	RNA transport	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0003725	double-stranded RNA binding	IBA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0051033	RNA transmembrane transporter activity	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0015485	cholesterol binding	IDA	molecular function
GO:0005764	lysosome	IBA	cellular component
GO:0051033	RNA transmembrane transporter activity	IBA	molecular function
GO:0050658	RNA transport	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0003725	double-stranded RNA binding	IBA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0051033	RNA transmembrane transporter activity	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0015485	cholesterol binding	IDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray