• Gene id: 54843

Gene Summary

• Gene Symbol: SYTL2   Gene   UCSC   Ensembl
• Aliases: CHR11SYT, EXO4, PPP1R151, SGA72M, SLP2, SLP2A
• Gene name: synaptotagmin like 2
• Alternate names: synaptotagmin-like protein 2, breast cancer-associated antigen SGA-72M, chromosome 11 synaptotagmin, exophilin-4, protein phosphatase 1, regulatory subunit 151,
• Gene location: 11q14.1 (85811181: 85694220)     Exons: 22     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene is a synaptotagmin-like protein (SLP) that belongs to a C2 domain-containing protein family. The SLP homology domain (SHD) of this protein has been shown to specifically bind the GTP-bound form of Ras-related protein Rab-2
• OMIM: 300547

Protein Summary

• Protein general information: Q9HCH5  
  • Name: Synaptotagmin like protein 2 (Breast cancer associated antigen SGA 72M) (Exophilin 4)
  • Length: 934  
  • Mass: 104930
  • Tissue specificity: Isoform 1 is expressed in hematopoietic lineages with a strong expression in CD4 and CD8 T-lymphocytes. It is also widely expressed in nonhematopoietic tissues. Isoform 5 is expressed only in nonhematopoietic tissues. Isoform 4 is expr
• Sequence:

  MIDLSFLTEEEQEAIMKVLQRDAALKRAEEERVRHLPEKIKDDQQLKNMSGQWFYEAKAKRHRDKIHGADIIRAS
  MRKKRPQIAAEQSKDRENGAKESWVNNVNKDAFLPPELAGVVEEPEEDAAPASPSSSVVNPASSVIDMSQENTRK
  PNVSPEKRKNPFNSSKLPEGHSSQQTKNEQSKNGRTGLFQTSKEDELSESKEKSTVADTSIQKLEKSKQTLPGLS
  NGSQIKAPIPKARKMIYKSTDLNKDDNQSFPRQRTDSLKARGAPRGILKRNSSSSSTDSETLRYNHNFEPKSKIV
  SPGLTIHERISEKEHSLEDNSSPNSLEPLKHVRFSAVKDELPQSPGLIHGREVGEFSVLESDRLKNGMEDAGDTE
  EFQSDPKPSQYRKPSLFHQSTSSPYVSKSETHQPMTSGSFPINGLHSHSEVLTARPQSMENSPTINEPKDKSSEL
  TRLESVLPRSPADELSHCVEPEPSQVPGGSSRDRQQGSEEEPSPVLKTLERSAARKMPSKSLEDISSDSSNQAKV
  DNQPEELVRSAEDVSTVPTQPDNPFSHPDKLKRMSKSVPAFLQDESDDRETDTASESSYQLSRHKKSPSSLTNLS
  SSSGMTSLSSVSGSVMSVYSGDFGNLEVKGNIQFAIEYVESLKELHVFVAQCKDLAAADVKKQRSDPYVKAYLLP
  DKGKMGKKKTLVVKKTLNPVYNEILRYKIEKQILKTQKLNLSIWHRDTFKRNSFLGEVELDLETWDWDNKQNKQL
  RWYPLKRKTAPVALEAENRGEMKLALQYVPEPVPGKKLPTTGEVHIWVKECLDLPLLRGSHLNSFVKCTILPDTS
  RKSRQKTRAVGKTTNPIFNHTMVYDGFRPEDLMEACVELTVWDHYKLTNQFLGGLRIGFGTGKSYGTEVDWMDST
  SEEVALWEKMVNSPNTWIEATLPLRMLLIAKISK

• Structural information:
  • Protein Domains: (1..5-)
    (/note="RabBD-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00234-)
    (628..75-)
    (/note="C2-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00041-)
    (768..89-)
    (/note="C2-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00041"-)
  • Interpro: IPR000008  IPR035892  IPR041282  IPR010911  IPR027006   IPR013083  
  • Prosite: PS50004 PS50916
  • PDB: 3BC1
  • PDBsum: 3BC1
  • STRING: ENSP00000318803
• Other Databases: GeneCards:  SYTL2  Malacards:  SYTL2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042043	neurexin family protein binding	ISS	molecular function
GO:0019897	extrinsic component of plasma membrane	ISS	cellular component
GO:0042470	melanosome	ISS	cellular component
GO:0016020	membrane	ISS	cellular component
GO:0001786	phosphatidylserine binding	IEA	molecular function
GO:0017137	Rab GTPase binding	IEA	molecular function
GO:0006886	intracellular protein transport	IEA	biological process
GO:0006887	exocytosis	IEA	biological process
GO:0070382	exocytic vesicle	IEA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0006887	exocytosis	IBA	biological process
GO:0042043	neurexin family protein binding	IBA	molecular function
GO:0070382	exocytic vesicle	IBA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006887	exocytosis	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042470	melanosome	IEA	cellular component
GO:0042043	neurexin family protein binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0006887	exocytosis	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0072659	protein localization to plasma membrane	IEA	biological process
GO:0070257	positive regulation of mucus secretion	IEA	biological process
GO:0019897	extrinsic component of plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0070382	exocytic vesicle	IDA	cellular component
GO:0019902	phosphatase binding	IDA	molecular function
GO:0010923	negative regulation of phosphatase activity	IDA	biological process
GO:0006904	vesicle docking involved in exocytosis	IDA	biological process
GO:0006887	exocytosis	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0016192	vesicle-mediated transport	ISS	biological process
GO:0001786	phosphatidylserine binding	IMP	molecular function
GO:0005546	phosphatidylinositol-4,5-bisphosphate binding	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R