• Gene id: 54829

Gene Summary

• Gene Symbol: ASPN   Gene   UCSC   Ensembl
• Aliases: OS3, PLAP-1, PLAP1, SLRR1C
• Gene name: asporin
• Alternate names: asporin, asporin (LRR class 1), asporin proteoglycan, periodontal ligament associated protein 1, small leucine-rich protein 1C,
• Gene location: 9q22.31 (10434221: 10401008)     Exons: 7     NC_000020.11
• Gene summary(Entrez): This gene encodes a cartilage extracellular protein that is member of the small leucine-rich proteoglycan family. The encoded protein may regulate chondrogenesis by inhibiting transforming growth factor-beta 1-induced gene expression in cartilage. This pr
• OMIM: 608135

Protein Summary

• Protein general information: Q9BXN1  
  • Name: Asporin (Periodontal ligament associated protein 1) (PLAP 1)
  • Length: 380  
  • Mass: 43417
  • Tissue specificity: Higher levels in osteoarthritic articular cartilage, aorta, uterus. Moderate expression in small intestine, heart, liver, bladder, ovary, stomach, and in the adrenal, thyroid, and mammary glands. Low expression in trachea, bone marrow,
• Sequence:

  MKEYVLLLFLALCSAKPFFSPSHIALKNMMLKDMEDTDDDDDDDDDDDDDDEDNSLFPTREPRSHFFPFDLFPMC
  PFGCQCYSRVVHCSDLGLTSVPTNIPFDTRMLDLQNNKIKEIKENDFKGLTSLYGLILNNNKLTKIHPKAFLTTK
  KLRRLYLSHNQLSEIPLNLPKSLAELRIHENKVKKIQKDTFKGMNALHVLEMSANPLDNNGIEPGAFEGVTVFHI
  RIAEAKLTSVPKGLPPTLLELHLDYNKISTVELEDFKRYKELQRLGLGNNKITDIENGSLANIPRVREIHLENNK
  LKKIPSGLPELKYLQIIFLHSNSIARVGVNDFCPTVPKMKKSLYSAISLFNNPVKYWEMQPATFRCVLSRMSVQL
  GNFGM

• Structural information:
  • Protein Domains: (66..10-)
    (/note="LRRNT"-)
  • Interpro: IPR028548  IPR001611  IPR003591  IPR032675  IPR000372   IPR016352  
  • Prosite: PS51450
  • STRING: ENSP00000364694
• Other Databases: GeneCards:  ASPN  Malacards:  ASPN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0031012	extracellular matrix	IDA	cellular component
GO:0005509	calcium ion binding	IDA	molecular function
GO:0030512	negative regulation of transforming growth factor beta receptor signaling pathway	IDA	biological process
GO:0030282	bone mineralization	IDA	biological process
GO:0070171	negative regulation of tooth mineralization	ISS	biological process
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005518	collagen binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0031214	biomineral tissue development	IEA	biological process
GO:0031012	extracellular matrix	IEA	cellular component
GO:0070171	negative regulation of tooth mineralization	IEA	biological process
GO:0030512	negative regulation of transforming growth factor beta receptor signaling pathway	IEA	biological process
GO:0030021	extracellular matrix structural constituent conferring compression resistance	RCA	molecular function
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	colocalizes with
GO:0030021	extracellular matrix structural constituent conferring compression resistance	RCA	molecular function
GO:0030021	extracellular matrix structural constituent conferring compression resistance	RCA	molecular function
GO:0030021	extracellular matrix structural constituent conferring compression resistance	RCA	molecular function
GO:0030021	extracellular matrix structural constituent conferring compression resistance	RCA	molecular function
GO:0030021	extracellular matrix structural constituent conferring compression resistance	RCA	molecular function
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component

Diseases

Associated diseases	References
Ankylosing spondylitis	PMID:20144272
Degenerative disc disease	PMID:19327154
Degenerative disc disease	PMID:18304494
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)