• Gene id: 54828

Gene Summary

• Gene Symbol: BCAS3   Gene   UCSC   Ensembl
• Aliases: GAOB1, MAAB
• Gene name: BCAS3 microtubule associated cell migration factor
• Alternate names: breast carcinoma-amplified sequence 3, BCAS4/BCAS3 fusion, Rudhira, breast carcinoma amplified sequence 4/3 fusion protein, metastasis associated antigen of breast cancer, protein Maab1,
• Gene location: 17q23.2 (60677850: 61392830)     Exons: 40     NC_000017.11
• OMIM: 607470

Protein Summary

• Protein general information: Q9H6U6  
  • Name: Breast carcinoma amplified sequence 3 (GAOB1)
  • Length: 928  
  • Mass: 101237
  • Tissue specificity: Expressed in stomach, liver, lung, kidney, prostate, testis, thyroid gland, adrenal gland, brain, heart, skeletal muscle, colon, spleen, small intestine, placenta, blood leukocyte and mammary epithelial cells. Expressed in undifferenti
• Sequence:

  MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSR
  NLEFHEIHSTGNEPPLLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLG
  VCKSIGSSGTSPPYCCVDLYSLRTGEMVKSIQFKTPIYDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCYPC
  PGPNMNPIALGSRWLAYAENKLIRCHQSRGGACGDNIQSYTATVISAAKTLKSGLTMVGKVVTQLTGTLPSGVTE
  DDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFNTSGMLLVTTDTLGHD
  FHVFQILTHPWSSSQCAVHHLYTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPYGGQPCVRTHMSPR
  VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSYNNFTNNNPGNPRLSPLPSLMV
  VMPLAQIKQPMTLGTITKRTGPYLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKR
  EKDQSKQVVVESLYIISCYGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPL
  LLAADAVQYYQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIH
  PSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASGT
  FDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLADAMAESPSRDVVGSGTELQREGSIETLSNSSGSTSGS
  IPRNFDGYRSPLPTNESQPLSLFPTGFP

• Structural information:
  • Interpro: IPR022175  IPR015943  IPR036322  
  • STRING: ENSP00000375067
• Other Databases: GeneCards:  BCAS3  Malacards:  BCAS3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0042594	response to starvation	IBA	biological process
GO:0010698	acetyltransferase activator activity	IDA	molecular function
GO:0042393	histone binding	IDA	molecular function
GO:0003682	chromatin binding	IDA	molecular function
GO:0035327	transcriptionally active chromatin	IDA	cellular component
GO:0048487	beta-tubulin binding	IDA	molecular function
GO:0043085	positive regulation of catalytic activity	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0071391	cellular response to estrogen stimulus	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:2000114	regulation of establishment of cell polarity	ISS	biological process
GO:0090316	positive regulation of intracellular protein transport	ISS	biological process
GO:0051895	negative regulation of focal adhesion assembly	ISS	biological process
GO:0051491	positive regulation of filopodium assembly	ISS	biological process
GO:0035148	tube formation	ISS	biological process
GO:0034260	negative regulation of GTPase activity	ISS	biological process
GO:0090630	activation of GTPase activity	ISS	biological process
GO:0010595	positive regulation of endothelial cell migration	ISS	biological process
GO:0035035	histone acetyltransferase binding	IPI	molecular function
GO:0035257	nuclear hormone receptor binding	IPI	molecular function
GO:0045111	intermediate filament cytoskeleton	ISS	cellular component
GO:0031252	cell leading edge	ISS	cellular component
GO:0005881	cytoplasmic microtubule	ISS	cellular component
GO:2000251	positive regulation of actin cytoskeleton reorganization	ISS	biological process
GO:0043547	positive regulation of GTPase activity	ISS	biological process
GO:0031023	microtubule organizing center organization	ISS	biological process
GO:0007030	Golgi organization	ISS	biological process
GO:0008134	transcription factor binding	IPI	molecular function
GO:0001525	angiogenesis	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000251	positive regulation of actin cytoskeleton reorganization	IEA	biological process
GO:0045111	intermediate filament cytoskeleton	IEA	cellular component
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0031252	cell leading edge	IEA	cellular component
GO:0031023	microtubule organizing center organization	IEA	biological process
GO:0007030	Golgi organization	IEA	biological process
GO:0005881	cytoplasmic microtubule	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:2000114	regulation of establishment of cell polarity	IEA	biological process
GO:0090630	activation of GTPase activity	IEA	biological process
GO:0090316	positive regulation of intracellular protein transport	IEA	biological process
GO:0071944	cell periphery	IEA	cellular component
GO:0051895	negative regulation of focal adhesion assembly	IEA	biological process
GO:0051491	positive regulation of filopodium assembly	IEA	biological process
GO:0035148	tube formation	IEA	biological process
GO:0034260	negative regulation of GTPase activity	IEA	biological process
GO:0010595	positive regulation of endothelial cell migration	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Breast cancer	PMID:16855396
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq