• Gene id: 54820

Gene Summary

• Gene Symbol: NDE1   Gene   UCSC   Ensembl
• Aliases: HOM-TES-87, LIS4, MHAC, NDE, NUDE, NUDE1
• Gene name: nudE neurodevelopment protein 1
• Alternate names: nuclear distribution protein nudE homolog 1, LIS1-interacting protein NUDE1, rat homolog, epididymis secretory sperm binding protein, nudE nuclear distribution E homolog 1, nudE nuclear distribution gene E homolog 1,
• Gene location: 16p13.11 (15643266: 15726352)     Exons: 16     NC_000016.10
• Gene summary(Entrez): This gene encodes a member of the nuclear distribution E (NudE) family of proteins. The encoded protein is localized at the centrosome and interacts with other centrosome components as part of a multiprotein complex that regulates dynein function. This pr
• OMIM: 600417

Protein Summary

• Protein general information: Q9NXR1  
  • Name: Nuclear distribution protein nudE homolog 1 (NudE)
  • Length: 335  
  • Mass: 37721
  • Tissue specificity: Expressed in the neuroepithelium throughout the developing brain, including the cerebral cortex and cerebellum. {ECO
• Sequence:

  MEDSGKTFSSEEEEANYWKDLAMTYKQRAENTQEELREFQEGSREYEAELETQLQQIETRNRDLLSENNRLRMEL
  ETIKEKFEVQHSEGYRQISALEDDLAQTKAIKDQLQKYIRELEQANDDLERAKRATIMSLEDFEQRLNQAIERNA
  FLESELDEKENLLESVQRLKDEARDLRQELAVQQKQEKPRTPMPSSVEAERTDTAVQATGSVPSTPIAHRGPSSS
  LNTPGSFRRGLDDSTGGTPLTPAARISALNIVGDLLRKVGALESKLASCRNLVYDQSPNRTGGPASGRSSKNRDG
  GERRPSSTSVPLGDKGLDTSCRWLSKSTTRSSSSC

• Structural information:
  • Interpro: IPR033494  IPR006964  
  • STRING: ENSP00000379643
• Other Databases: GeneCards:  NDE1  Malacards:  NDE1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000132	establishment of mitotic spindle orientation	IBA	biological process
GO:0000776	kinetochore	IBA	cellular component
GO:0005813	centrosome	IBA	cellular component
GO:0005871	kinesin complex	IBA	cellular component
GO:0007020	microtubule nucleation	IBA	biological process
GO:0008017	microtubule binding	IBA	molecular function
GO:0016477	cell migration	IBA	biological process
GO:0047496	vesicle transport along microtubule	IBA	biological process
GO:0051303	establishment of chromosome localization	IBA	biological process
GO:0007059	chromosome segregation	IBA	biological process
GO:0007100	mitotic centrosome separation	IBA	biological process
GO:0051642	centrosome localization	IBA	biological process
GO:0005813	centrosome	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0000132	establishment of mitotic spindle orientation	IMP	biological process
GO:0021987	cerebral cortex development	IMP	biological process
GO:2000574	regulation of microtubule motor activity	IEA	biological process
GO:0000776	kinetochore	IEA	cellular component
GO:0051301	cell division	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0005694	chromosome	IEA	cellular component
GO:0007399	nervous system development	IEA	biological process
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0005874	microtubule	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0000086	G2/M transition of mitotic cell cycle	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0010389	regulation of G2/M transition of mitotic cell cycle	TAS	biological process
GO:0097711	ciliary basal body-plasma membrane docking	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051298	centrosome duplication	IEA	biological process
GO:0047496	vesicle transport along microtubule	IEA	biological process
GO:0031616	spindle pole centrosome	IEA	cellular component
GO:0008017	microtubule binding	IEA	molecular function
GO:0007405	neuroblast proliferation	IEA	biological process
GO:0007020	microtubule nucleation	IEA	biological process
GO:0005813	centrosome	IEA	cellular component
GO:0001764	neuron migration	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0042802	identical protein binding	IEA	molecular function
GO:0031023	microtubule organizing center organization	IEA	biological process
GO:0030900	forebrain development	IEA	biological process
GO:0021987	cerebral cortex development	IEA	biological process
GO:0005819	spindle	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0019904	protein domain specific binding	IEA	molecular function
GO:0032154	cleavage furrow	IEA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0000777	condensed chromosome kinetochore	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0000776	kinetochore	IDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0031616	spindle pole centrosome	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0051303	establishment of chromosome localization	IMP	biological process
GO:0051298	centrosome duplication	ISS	biological process
GO:0008017	microtubule binding	ISS	molecular function

Diseases

Associated diseases	References
Lissencephaly	KEGG:H00268
Microhydranencephaly	KEGG:H01870
Lissencephaly	KEGG:H00268
Microhydranencephaly	KEGG:H01870
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq