• Gene id: 54815

Gene Summary

• Gene Symbol: GATAD2A   Gene   UCSC   Ensembl
• Aliases: p66alpha
• Gene name: GATA zinc finger domain containing 2A
• Alternate names: transcriptional repressor p66-alpha, GATA zinc finger domain-containing protein 2A,
• Gene location: 19p13.11 (19385802: 19508931)     Exons: 18     NC_000019.10
• OMIM: 614997

Protein Summary

• Protein general information: Q86YP4  
  • Name: Transcriptional repressor p66 alpha (Hp66alpha) (GATA zinc finger domain containing protein 2A)
  • Length: 633  
  • Mass: 68063
  • Tissue specificity: Ubiquitous, both in fetal and adult tissues. {ECO
• Sequence:

  MTEEACRTRSQKRALERDPTEDDVESKKIKMERGLLASDLNTDGDMRVTPEPGAGPTQGLLRATEATAMAMGRGE
  GLVGDGPVDMRTSHSDMKSERRPPSPDVIVLSDNEQPSSPRVNGLTTVALKETSTEALMKSSPEERERMIKQLKE
  ELRLEEAKLVLLKKLRQSQIQKEATAQKPTGSVGSTVTTPPPLVRGTQNIPAGKPSLQTSSARMPGSVIPPPLVR
  GGQQASSKLGPQASSQVVMPPLVRGAQQIHSIRQHSSTGPPPLLLAPRASVPSVQIQGQRIIQQGLIRVANVPNT
  SLLVNIPQPTPASLKGTTATSAQANSTPTSVASVVTSAESPASRQAAAKLALRKQLEKTLLEIPPPKPPAPEMNF
  LPSAANNEFIYLVGLEEVVQNLLETQGRMSAATVLSREPYMCAQCKTDFTCRWREEKSGAIMCENCMTTNQKKAL
  KVEHTSRLKAAFVKALQQEQEIEQRLLQQGTAPAQAKAEPTAAPHPVLKQVIKPRRKLAFRSGEARDWSNGAVLQ
  ASSQLSRGSATTPRGVLHTFSPSPKLQNSASATALVSRTGRHSERTVSAGKGSATSNWKKTPLSTGGTLAFVSPS
  LAVHKSSSAVDRQREYLLDMIPPRSIPQSATWK

• Structural information:
  • Interpro: IPR040386  IPR032346  IPR000679  
  • Prosite: PS00344 PS50114
  • PDB: 2L2L
  • PDBsum: 2L2L
  • DIP: 36053
  • STRING: ENSP00000353463
• Other Databases: GeneCards:  GATAD2A  Malacards:  GATAD2A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016581	NuRD complex	IBA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IBA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016607	nuclear speck	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0030674	protein-macromolecule adaptor activity	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0016581	NuRD complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0006306	DNA methylation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray