About Us

Search Result


Gene id 54811
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary

Gene Symbol ZNF562   Gene   UCSC   Ensembl
Gene name zinc finger protein 562
Alternate names zinc finger protein 562,
Gene location 19p13.2 (9675292: 9641806)     Exons: 6     NC_000019.10

Protein Summary

Protein general information Q6V9R5  

Name: Zinc finger protein 562

Length: 426  Mass: 48563

Sequence MSAFDMSHGFFPREPICPFEEKTKIGTMVEDHRSNSYQDSVTFDDVAVEFTPEEWALLDTTQKYLYRDVMLENYM
NLASVDFFFCLTSEWEIQPRTKRSSLQQGFLKNQIFTGIQMQTRSYSGWKLCENCGEVFSEQFCLKTHMRAQNGG
NTFEGNCYGKDSISVHKEASIGQELSKFNPCGKVFTLTPGLAVHLEILNGRQPYKCKECGKGFKYFASLDNHMGI
HIGEKLCEFQECERAITTSSHLKQCVAVHTGKKSEKTKNCGKSFTNFSQLSAHAKTHKGEKSFECKECGRSFRNS
SSFNVHIQIHTGIKPHKCTECGKAFTRSTHLTQHVRTHTGIKPYECKECGQAFTQYTGLAIHIRNHTGEKPYQCK
ECGKAFNRSSTLTQHRRIHTGEKPYECVECGKTFITSSHRSKHLKTHSGER
Structural information
Protein Domains
(41..12-)
(/note="KRAB-)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00119"-)
Interpro:  IPR001909  IPR036051  IPR036236  IPR013087  
Prosite:   PS50805 PS00028 PS50157
CDD:   cd07765
STRING:   ENSP00000410734
Other Databases GeneCards:  ZNF562  Malacards:  ZNF562

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0005634 nucleus
IBA cellular component
GO:0006355 regulation of transcripti
on, DNA-templated
IBA biological process
GO:0000978 RNA polymerase II cis-reg
ulatory region sequence-s
pecific DNA binding
IBA molecular function
GO:0003676 nucleic acid binding
IEA molecular function
GO:0006355 regulation of transcripti
on, DNA-templated
IEA biological process
GO:0046872 metal ion binding
IEA molecular function
GO:0005634 nucleus
IEA cellular component
GO:0003677 DNA binding
IEA molecular function
GO:0005634 nucleus
IEA cellular component

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa05168Herpes simplex virus 1 infection
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia

13 (5 controls,
8 cases)
Male infertility GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm

18
Male infertility GSE26881
Show abstract