• Gene id: 5481

Gene Summary

• Gene Symbol: PPID   Gene   UCSC   Ensembl
• Aliases: CYP-40, CYPD
• Gene name: peptidylprolyl isomerase D
• Alternate names: peptidyl-prolyl cis-trans isomerase D, 40 kDa peptidyl-prolyl cis-trans isomerase D, PPIase D, cyclophilin 40, cyclophilin D, cyclophilin-related protein, rotamase D, testicular tissue protein Li 147,
• Gene location: 4q32.1 (158723395: 158709126)     Exons: 10     NC_000004.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein has
• OMIM: 601753

Protein Summary

• Protein general information: Q08752  
  • Name: Peptidyl prolyl cis trans isomerase D (PPIase D) (EC 5.2.1.8) (40 kDa peptidyl prolyl cis trans isomerase) (Cyclophilin 40) (CYP 40) (Cyclophilin related protein) (Rotamase D)
  • Length: 370  
  • Mass: 40764
  • Tissue specificity: Widely expressed.
• Sequence:

  MSHPSPQAKPSNPSNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGHTTGKPLHFKGCPFHR
  IIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAGRNTNGSQFFITTVPTPHLDGKHVVFG
  QVIKGIGVARILENVEVKGEKPAKLCVIAECGELKEGDDGGIFPKDGSGDSHPDFPEDADIDLKDVDKILLITED
  LKNIGNTFFKSQNWEMAIKKYAEVLRYVDSSKAVIETADRAKLQPIALSCVLNIGACKLKMSNWQGAIDSCLEAL
  ELDPSNTKALYRRAQGWQGLKEYDQALADLKKAQGIAPEDKAIQAELLKVKQKIKAQKDKEKAVYAKMFA

• Structural information:
  • Protein Domains: (19..18-)
    (/note="PPIase-cyclophilin-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00156"-)
  • Interpro: IPR029000  IPR020892  IPR002130  IPR013026  IPR011990   IPR019734  
  • Prosite: PS00170 PS50072 PS50005 PS50293
  • DIP: 34893
  • STRING: ENSP00000303754
• Other Databases: GeneCards:  PPID  Malacards:  PPID

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000413	protein peptidyl-prolyl isomerization	IBA	biological process
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IBA	molecular function
GO:0006457	protein folding	IBA	biological process
GO:0016018	cyclosporin A binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0061077	chaperone-mediated protein folding	IDA	biological process
GO:0005730	nucleolus	IDA	cellular component
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IDA	molecular function
GO:0051879	Hsp90 protein binding	IDA	molecular function
GO:0008134	transcription factor binding	IDA	molecular function
GO:0065003	protein-containing complex assembly	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0016018	cyclosporin A binding	IDA	molecular function
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IDA	molecular function
GO:0000413	protein peptidyl-prolyl isomerization	IDA	biological process
GO:0045070	positive regulation of viral genome replication	IMP	biological process
GO:0006457	protein folding	ISS	biological process
GO:0071492	cellular response to UV-A	IMP	biological process
GO:0050714	positive regulation of protein secretion	IMP	biological process
GO:0043065	positive regulation of apoptotic process	IMP	biological process
GO:0034389	lipid droplet organization	IMP	biological process
GO:0030544	Hsp70 protein binding	ISS	molecular function
GO:0030331	estrogen receptor binding	ISS	molecular function
GO:0019076	viral release from host cell	TAS	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IMP	biological process
GO:0000413	protein peptidyl-prolyl isomerization	IEA	biological process
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IEA	molecular function
GO:0006457	protein folding	IEA	biological process
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IEA	molecular function
GO:0015031	protein transport	IEA	biological process
GO:0016032	viral process	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0016853	isomerase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016018	cyclosporin A binding	TAS	molecular function
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IEA	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016018	cyclosporin A binding	TAS	molecular function
GO:0031072	heat shock protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05010	Alzheimer disease
hsa05131	Shigellosis
hsa04217	Necroptosis
hsa04218	Cellular senescence

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)