• Gene id: 54802

Gene Summary

• Gene Symbol: TRIT1   Gene   UCSC   Ensembl
• Aliases: COXPD35, GRO1, IPPT, IPT, IPTase, MOD5, hGRO1
• Gene name: tRNA isopentenyltransferase 1
• Alternate names: tRNA dimethylallyltransferase, IPP transferase, isopentenyl-diphosphate:tRNA isopentenyltransferase, tRNA dimethylallyltransferase, mitochondrial, tRNA isopentenylpyrophosphate transferase,
• Gene location: 1p34.2 (39883510: 39838109)     Exons: 12     NC_000001.11
• Gene summary(Entrez): This gene encodes a protein that that is targeted to the mitochondrion and modifies transfer RNAs (tRNAs) by adding a dimethylallyl group onto the adenine at position 37. This modification is important for maintaining the correct reading frame during prot
• OMIM: 617840

Protein Summary

• Protein general information: Q9H3H1  
  • Name: tRNA dimethylallyltransferase (EC 2.5.1.75) (Isopentenyl diphosphate:tRNA isopentenyltransferase) (IPP transferase) (IPPT) (hGRO1) (tRNA isopentenyltransferase 1) (IPTase)
  • Length: 467  
  • Mass: 52725
• Sequence:

  MASVAAARAVPVGSGLRGLQRTLPLVVILGATGTGKSTLALQLGQRLGGEIVSADSMQVYEGLDIITNKVSAQEQ
  RICRHHMISFVDPLVTNYTVVDFRNRATALIEDIFARDKIPIVVGGTNYYIESLLWKVLVNTKPQEMGTEKVIDR
  KVELEKEDGLVLHKRLSQVDPEMAAKLHPHDKRKVARSLQVFEETGISHSEFLHRQHTEEGGGPLGGPLKFSNPC
  ILWLHADQAVLDERLDKRVDDMLAAGLLEELRDFHRRYNQKNVSENSQDYQHGIFQSIGFKEFHEYLITEGKCTL
  ETSNQLLKKGIEALKQVTKRYARKQNRWVKNRFLSRPGPIVPPVYGLEVSDVSKWEESVLEPALEIVQSFIQGHK
  PTATPIKMPYNEAENKRSYHLCDLCDRIIIGDREWAAHIKSKSHLNQLKKRRRLDSDAVNTIESQSVSPDHNKEP
  KEKGSPGQNDQELKCSV

• Structural information:
  • Interpro: IPR039657  IPR030666  IPR018022  IPR003604  IPR027417   IPR022755  IPR036236  
  • STRING: ENSP00000321810
• Other Databases: GeneCards:  TRIT1  Malacards:  TRIT1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0052381	tRNA dimethylallyltransferase activity	IBA	molecular function
GO:0006400	tRNA modification	IBA	biological process
GO:0005739	mitochondrion	IBA	cellular component
GO:0008033	tRNA processing	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0052381	tRNA dimethylallyltransferase activity	IEA	molecular function
GO:0008033	tRNA processing	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0052381	tRNA dimethylallyltransferase activity	IEA	molecular function
GO:0052381	tRNA dimethylallyltransferase activity	EXP	molecular function
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0070900	mitochondrial tRNA modification	TAS	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0052381	tRNA dimethylallyltransferase activity	TAS	molecular function
GO:0005575	cellular_component	ND	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)