• Gene id: 5480

Gene Summary

• Gene Symbol: PPIC   Gene   UCSC   Ensembl
• Aliases: CYPC
• Gene name: peptidylprolyl isomerase C
• Alternate names: peptidyl-prolyl cis-trans isomerase C, PPIase C, cyclophilin C, parvulin, rotamase C,
• Gene location: 5q23.2 (123036724: 123023249)     Exons: 5     NC_000005.10
• Gene summary(Entrez): The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase)) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. Similar to othe
• OMIM: 606058

Protein Summary

• Protein general information: P45877  
  • Name: Peptidyl prolyl cis trans isomerase C (PPIase C) (EC 5.2.1.8) (Cyclophilin C) (Rotamase C)
  • Length: 212  
  • Mass: 22763
  • Tissue specificity: Expressed in kidney, skeletal muscle, pancreas, heart, lung, liver and to a lower extent in brain. {ECO
• Sequence:

  MGPGPRLLLPLVLCVGLGALVFSSGAEGFRKRGPSVTAKVFFDVRIGDKDVGRIVIGLFGKVVPKTVENFVALAT
  GEKGYGYKGSKFHRVIKDFMIQGGDITTGDGTGGVSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITL
  TKPTWLDGKHVVFGKVIDGMTVVHSIELQATDGHDRPLTNCSIINSGKIDVKTPFVVEIADW

• Structural information:
  • Protein Domains: (41..19-)
    (/note="PPIase-cyclophilin-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00156"-)
  • Interpro: IPR029000  IPR024936  IPR020892  IPR002130  
  • Prosite: PS00170 PS50072
  • PDB: 2ESL
  • PDBsum: 2ESL
  • STRING: ENSP00000303057
• Other Databases: GeneCards:  PPIC  Malacards:  PPIC

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016018	cyclosporin A binding	IBA	molecular function
GO:0006457	protein folding	IBA	biological process
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IBA	molecular function
GO:0000413	protein peptidyl-prolyl isomerization	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0016018	cyclosporin A binding	IDA	molecular function
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IDA	molecular function
GO:0000413	protein peptidyl-prolyl isomerization	IDA	biological process
GO:0000413	protein peptidyl-prolyl isomerization	IEA	biological process
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IEA	molecular function
GO:0006457	protein folding	IEA	biological process
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IEA	molecular function
GO:0016853	isomerase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000413	protein peptidyl-prolyl isomerization	IEA	biological process
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016018	cyclosporin A binding	IDA	molecular function
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray