• Gene id: 5479

Gene Summary

• Gene Symbol: PPIB   Gene   UCSC   Ensembl
• Aliases: B, CYP-S1, CYPB, HEL-S-39, OI9, SCYLP
• Gene name: peptidylprolyl isomerase B
• Alternate names: peptidyl-prolyl cis-trans isomerase B, PPIase B, S-cyclophilin, cyclophilin-like protein, epididymis secretory protein Li 39, peptidylprolyl isomerase B (cyclophilin B), rotamase B,
• Gene location: 15q22.31 (141231824: 141294923)     Exons: 11     NC_000003.12
• Gene summary(Entrez): The protein encoded by this gene is a cyclosporine-binding protein and is mainly located within the endoplasmic reticulum. It is associated with the secretory pathway and released in biological fluids. This protein can bind to cells derived from T- and B-
• OMIM: 123841

Protein Summary

• Protein general information: P23284  
  • Name: Peptidyl prolyl cis trans isomerase B (PPIase B) (EC 5.2.1.8) (CYP S1) (Cyclophilin B) (Rotamase B) (S cyclophilin) (SCYLP)
  • Length: 216  
  • Mass: 23743
• Sequence:

  MLRLSERNMKVLLAAALIAGSVFFLLLPGPSAADEKKKGPKVTVKVYFDLRIGDEDVGRVIFGLFGKTVPKTVDN
  FVALATGEKGFGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMANAGKDTNGS
  QFFITTVKTAWLDGKHVVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIADCGKIEVEKPFAIAKE

• Structural information:
  • Protein Domains: (47..20-)
    (/note="PPIase-cyclophilin-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00156"-)
  • Interpro: IPR029000  IPR024936  IPR020892  IPR002130  
  • Prosite: PS00170 PS50072
  • PDB: 1CYN 3ICH 3ICI
  • PDBsum: 1CYN 3ICH 3ICI
  • STRING: ENSP00000300026
• Other Databases: GeneCards:  PPIB  Malacards:  PPIB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000413	protein peptidyl-prolyl isomerization	IBA	biological process
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IBA	molecular function
GO:0006457	protein folding	IBA	biological process
GO:0016018	cyclosporin A binding	IBA	molecular function
GO:0043231	intracellular membrane-bounded organelle	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0016018	cyclosporin A binding	IDA	molecular function
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IDA	molecular function
GO:0000413	protein peptidyl-prolyl isomerization	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0000413	protein peptidyl-prolyl isomerization	IEA	biological process
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IEA	molecular function
GO:0006457	protein folding	IEA	biological process
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016853	isomerase activity	IEA	molecular function
GO:0051082	unfolded protein binding	TAS	molecular function
GO:0005783	endoplasmic reticulum	TAS	cellular component
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IEA	molecular function
GO:0070063	RNA polymerase binding	IPI	molecular function
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0044829	positive regulation by host of viral genome replication	IMP	biological process
GO:0044794	positive regulation by host of viral process	IMP	biological process
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005790	smooth endoplasmic reticulum	IEA	cellular component
GO:0034663	endoplasmic reticulum chaperone complex	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005788	endoplasmic reticulum lumen	IEA	cellular component
GO:0042470	melanosome	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0061077	chaperone-mediated protein folding	IDA	biological process
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0050821	protein stabilization	IMP	biological process
GO:0040018	positive regulation of multicellular organism growth	IMP	biological process
GO:0032991	protein-containing complex	ISS	cellular component
GO:0000413	protein peptidyl-prolyl isomerization	ISS	biological process
GO:0005634	nucleus	HDA	cellular component
GO:0005518	collagen binding	ISS	contributes to
GO:0016020	membrane	HDA	cellular component
GO:1901873	regulation of post-translational protein modification	IMP	NOT|biological process
GO:0060348	bone development	IMP	biological process
GO:0005515	protein binding	ISS	molecular function
GO:0005925	focal adhesion	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0061077	chaperone-mediated protein folding	IMP	NOT|biological process
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	ISS	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005788	endoplasmic reticulum lumen	NAS	cellular component
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	NAS	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Osteogenesis imperfecta	KEGG:H00506
Osteogenesis imperfecta	KEGG:H00506
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray