• Gene id: 54766

Gene Summary

• Gene Symbol: BTG4   Gene   UCSC   Ensembl
• Aliases: APRO3, PC3B
• Gene name: BTG anti-proliferation factor 4
• Alternate names: protein BTG4, B-cell translocation gene 4, BTG family member 4, protein PC3b,
• Gene location: 11q23.1 (111514733: 111383827)     Exons: 20     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein can induce G1 arrest in the cell cycle. [provided by RefSeq, Jul 2008]
• OMIM: 605673

SNPs

rs4938723

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000011.10   g.111511840T>C
NC_000011.9   g.111382565T>C|SEQ=[T/C]|GENE=BTG4
MIR34B   407041
MIR34C   407042
LOC728196   728196

Protein Summary

• Protein general information: Q9NY30  
  • Name: Protein BTG4 (BTG family member 4) (Protein PC3b)
  • Length: 223  
  • Mass: 25970
  • Tissue specificity: Highly expressed in testis and in olfactory epithelium.
• Sequence:

  MRDEIATTVFFVTRLVKKHDKLSKQQIEDFAEKLMTILFETYRSHWHSDCPSKGQAFRCIRINNNQNKDPILERA
  CVESNVDFSHLGLPKEMTIWVDPFEVCCRYGEKNHPFTVASFKGRWEEWELYQQISYAVSRASSDVSSGTSCDEE
  SCSKEPRVIPKVSNPKSIYQVENLKQPFQSWLQIPRKKNVVDGRVGLLGNTYHGSQKHPKCYRPAMHRLDRIL

• Structural information:
  • Interpro: IPR002087  IPR036054  IPR033332  
  • Prosite: PS00960 PS01203
  • STRING: ENSP00000348300
• Other Databases: GeneCards:  BTG4  Malacards:  BTG4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008285	negative regulation of cell population proliferation	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0045930	negative regulation of mitotic cell cycle	IBA	biological process
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0045930	negative regulation of mitotic cell cycle	IEA	biological process
GO:0030182	neuron differentiation	TAS	biological process
GO:0005575	cellular_component	ND	cellular component
GO:0008285	negative regulation of cell population proliferation	TAS	biological process
GO:0007050	cell cycle arrest	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa03018	RNA degradation

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R