• Gene id: 54765

Gene Summary

• Gene Symbol: TRIM44   Gene   UCSC   Ensembl
• Aliases: AN3, DIPB, HSA249128, MC7
• Gene name: tripartite motif containing 44
• Alternate names: tripartite motif-containing protein 44,
• Gene location: 11p13 (179451469: 179396087)     Exons: 12     NC_000003.12
• Gene summary(Entrez): This gene encodes a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, namely a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. [provided by RefSeq, Jul 2008]
• OMIM: 612298

Protein Summary

• Protein general information: Q96DX7  
  • Name: Tripartite motif containing protein 44 (Protein DIPB)
  • Length: 344  
  • Mass: 38472
  • Tissue specificity: Highly expressed in testis. {ECO
• Sequence:

  MASGVGAAFEELPHDGTCDECEPDEAPGAEEVCRECGFCYCRRHAEAHRQKFLSHHLAEYVHGSQAWTPPADGEG
  AGKEEAEVKVEQEREIESEAGEESESEEESESEEESETEEESEDESDEESEEDSEEEMEDEQESEAEEDNQEEGE
  SEAEGETEAESEFDPEIEMEAERVAKRKCPDHGLDLSTYCQEDRQLICVLCPVIGAHQGHQLSTLDEAFEELRSK
  DSGGLKAAMIELVERLKFKSSDPKVTRDQMKMFIQQEFKKVQKVIADEEQKALHLVDIQEAMATAHVTEILADIQ
  SHMDRLMTQMAQAKEQLDTSNESAEPKAEGDEEGPSGASEEEDT

• Structural information:
  • Interpro: IPR000315  
  • Prosite: PS50119
  • CDD: cd00021
  • STRING: ENSP00000299413
• Other Databases: GeneCards:  TRIM44  Malacards:  TRIM44

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0010468	regulation of gene expression	IBA	biological process
GO:0016567	protein ubiquitination	IBA	biological process
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0010468	regulation of gene expression	IMP	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0050821	protein stabilization	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:1901224	positive regulation of NIK/NF-kappaB signaling	IDA	biological process
GO:0001961	positive regulation of cytokine-mediated signaling pathway	IDA	biological process
GO:0002230	positive regulation of defense response to virus by host	IDA	biological process
GO:0061944	negative regulation of protein K48-linked ubiquitination	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aniridia	KEGG:H00635
Aniridia	KEGG:H00635
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq