• Gene id: 54756

Gene Summary

• Gene Symbol: IL17RD   Gene   UCSC   Ensembl
• Aliases: HH18, IL-17RD, IL17RLM, SEF
• Gene name: interleukin 17 receptor D
• Alternate names: interleukin-17 receptor D, IL-17 receptor D, IL17Rhom, interleukin-17 receptor-like protein, sef homolog,
• Gene location: 3p14.3 (57170316: 57089981)     Exons: 16     NC_000003.12
• Gene summary(Entrez): This gene encodes a membrane protein belonging to the interleukin-17 receptor (IL-17R) protein family. The encoded protein is a component of the interleukin-17 receptor signaling complex, and the interaction between this protein and IL-17R does not requir
• OMIM: 606807

Protein Summary

• Protein general information: Q8NFM7  
  • Name: Interleukin 17 receptor D (IL 17 receptor D) (IL 17RD) (IL17Rhom) (Interleukin 17 receptor like protein) (Sef homolog) (hSef)
  • Length: 739  
  • Mass: 82,411
• Sequence:

  MAPWLQLCSVFFTVNACLNGSQLAVAAGGSGRARGADTCGWRGVGPASRNSGLYNITFKYDNCTTYLNPVGKHVI
  ADAQNITISQYACHDQVAVTILWSPGALGIEFLKGFRVILEELKSEGRQCQQLILKDPKQLNSSFKRTGMESQPF
  LNMKFETDYFVKVVPFPSIKNESNYHPFFFRTRACDLLLQPDNLACKPFWKPRNLNISQHGSDMQVSFDHAPHNF
  GFRFFYLHYKLKHEGPFKRKTCKQEQTTETTSCLLQNVSPGDYIIELVDDTNTTRKVMHYALKPVHSPWAGPIRA
  VAITVPLVVISAFATLFTVMCRKKQQENIYSHLDEESSESSTYTAALPRERLRPRPKVFLCYSSKDGQNHMNVVQ
  CFAYFLQDFCGCEVALDLWEDFSLCREGQREWVIQKIHESQFIIVVCSKGMKYFVDKKNYKHKGGGRGSGKGELF
  LVAVSAIAEKLRQAKQSSSAALSKFIAVYFDYSCEGDVPGILDLSTKYRLMDNLPQLCSHLHSRDHGLQEPGQHT
  RQGSRRNYFRSKSGRSLYVAICNMHQFIDEEPDWFEKQFVPFHPPPLRYREPVLEKFDSGLVLNDVMCKPGPESD
  FCLKVEAAVLGATGPADSQHESQHGGLDQDGEARPALDGSAALQPLLHTVKAGSPSDMPRDSGIYDSSVPSSELS
  LPLMEGLSTDQTETSSLTESVSSSSGLGEEEPPALPSKLLSSGSCKADLGCRSYTDELHAVAPL

• Structural information:
  • Protein Domains: SEFIR. (355-509)
  • Interpro: IPR031951  IPR013568  IPR035897  
  • Prosite: PS51534
  • STRING: ENSP00000296318
• Other Databases: GeneCards:  IL17RD  Malacards:  IL17RD

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000165	MAPK cascade	TAS	biological process
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0019221	cytokine-mediated signaling pathway	IEA	biological process
GO:0030368	interleukin-17 receptor activity	IBA	molecular function
GO:0000139	Golgi membrane	IEA	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000165	MAPK cascade	TAS	biological process
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0019221	cytokine-mediated signaling pathway	IEA	biological process
GO:0030368	interleukin-17 receptor activity	IBA	molecular function
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000165	MAPK cascade	TAS	biological process
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0030368	interleukin-17 receptor activity	IBA	molecular function

Diseases

Associated diseases	References
Kallmann syndrome (KS)	MIK: 23643382
Male factor infertility	MIK: 23643382
Hypogonadotropic hypogonadism	MIK: 25636053
Chronic renal failure	GAD: 21085059
Kallmann syndrome (KS)	MIK: 23643382
Congenital hypogonadotropic hypogonadism (CHH)	MIK: 23643382
Idiopathic hypogonadotropic hypogonadism (IHH)	MIK: 25636053
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25636053	Idiopathic hypogonadotropic hypogonadism (IHH)			963 (75 Idiopathic hypogonadotropic hypogonadism (IHH), 888 controls)	Male infertility, Female infertility	IL17RD TAC3
23643382	Congenital hypogonadotropic hypogonadism (CHH), Kallmann syndrome (KS)			541 (386 unrelated CHH individuals, 155 controls)	Male infertility	FGF17 IL17RD DUSP6 SPRY4 and FLRT3
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray