• Gene id: 54738

Gene Summary

• Gene Symbol: FEV   Gene   UCSC   Ensembl
• Aliases: HSRNAFEV, PET-1
• Gene name: FEV transcription factor, ETS family member
• Alternate names: protein FEV, FEV (ETS oncogene family), FEV, ETS transcription factor, PC12 ETS domain-containing transcription factor 1, fifth Ewing variant protein,
• Gene location: 2q35 (176388926: 176383936)     Exons: 6     NC_000005.10
• Gene summary(Entrez): This gene belongs to the ETS transcription factor family. ETS family members have a highly conserved 85-amino acid ETS domain that binds purine-rich DNA sequences. The alanine-rich C-terminus of this gene indicates that it may act as a transcription repre
• OMIM: 607150

Protein Summary

• Protein general information: Q99581  
  • Name: Protein FEV (Fifth Ewing variant protein) (PC12 ETS domain containing transcription factor 1) (PC12 ETS factor 1) (Pet 1)
  • Length: 238  
  • Mass: 25030
  • Tissue specificity: In brain, exclusively expressed in the major serotonergic neurons of the dorsal and median raphe nuclei located in the midbrain and pons. Also detected in prostate and small intestine. {ECO
• Sequence:

  MRQSGASQPLLINMYLPDPVGDGLFKDGKNPSWGPLSPAVQKGSGQIQLWQFLLELLADRANAGCIAWEGGHGEF
  KLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYRFDFQGLAQACQPPPAHAHAAAAAAA
  AAAAAQDGALYKLPAGLAPLPFPGLSKLNLMAASAGVAPAGFSYWPGPGPAATAAAATAALYPSPSLQPPPGPFG
  AVAAASHLGGHYH

• Structural information:
  • Interpro: IPR000418  IPR036388  IPR036390  
  • Prosite: PS00345 PS00346 PS50061
  • PDB: 2YPR 3ZP5
  • PDBsum: 2YPR 3ZP5
  • STRING: ENSP00000295727
• Other Databases: GeneCards:  FEV  Malacards:  FEV

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0030154	cell differentiation	IBA	biological process
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0007399	nervous system development	IEA	biological process
GO:0042551	neuron maturation	IEA	biological process
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0048665	neuron fate specification	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:1903507	negative regulation of nucleic acid-templated transcription	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa05202	Transcriptional misregulation in cancer

Diseases

Associated diseases	References
Ewing sarcoma	KEGG:H00035
Ewing sarcoma	KEGG:H00035
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)