• Gene id: 5473

Gene Summary

• Gene Symbol: PPBP   Gene   UCSC   Ensembl
• Aliases: B-TG1, Beta-TG, CTAP-III, CTAP3, CTAPIII, CXCL7, LA-PF4, LDGF, MDGF, NAP-2, PBP, SCYB7, TC1, TC2, TGB, TGB1, THBGB, THBGB1
• Gene name: pro-platelet basic protein
• Alternate names: platelet basic protein, C-X-C motif chemokine 7, CXC chemokine ligand 7, beta-thromboglobulin, chemokine (C-X-C motif) ligand 7, connective tissue-activating peptide III, leukocyte-derived growth factor, low-affinity platelet factor IV, macrophage-derived growth ,
• Gene location: 4q13.3 (73988189: 73986438)     Exons: 3     NC_000004.12
• Gene summary(Entrez): The protein encoded by this gene is a platelet-derived growth factor that belongs to the CXC chemokine family. This growth factor is a potent chemoattractant and activator of neutrophils. It has been shown to stimulate various cellular processes including
• OMIM: 611288

Protein Summary

• Protein general information: P02775  
  • Name: Platelet basic protein (PBP) (C X C motif chemokine 7) (Leukocyte derived growth factor) (LDGF) (Macrophage derived growth factor) (MDGF) (Small inducible cytokine B7) [Cleaved into: Connective tissue activating peptide III (CTAP III) (LA PF4) (Low affini
  • Length: 128  
  • Mass: 13894
• Sequence:

  MSLRLDTTPSCNSARPLHALQVLLLLSLLLTALASSTKGQTKRNLAKGKEESLDSDLYAELRCMCIKTTSGIHPK
  NIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD

• Structural information:
  • Interpro: IPR001089  IPR018048  IPR001811  IPR033899  IPR036048  
  • Prosite: PS00471
  • CDD: cd00273
  • PDB: 1F9P 1NAP 1TVX
  • PDBsum: 1F9P 1NAP 1TVX
  • DIP: 5913
  • STRING: ENSP00000296028
• Other Databases: GeneCards:  PPBP  Malacards:  PPBP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045236	CXCR chemokine receptor binding	IBA	molecular function
GO:0030595	leukocyte chemotaxis	IBA	biological process
GO:0006955	immune response	IBA	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0071222	cellular response to lipopolysaccharide	IBA	biological process
GO:0070098	chemokine-mediated signaling pathway	IBA	biological process
GO:0061844	antimicrobial humoral immune response mediated by antimicrobial peptide	IBA	biological process
GO:0030593	neutrophil chemotaxis	IBA	biological process
GO:0008009	chemokine activity	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0006952	defense response	IEA	biological process
GO:0008009	chemokine activity	IEA	molecular function
GO:0006935	chemotaxis	IEA	biological process
GO:0006955	immune response	IEA	biological process
GO:0051781	positive regulation of cell division	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0006935	chemotaxis	IEA	biological process
GO:0008083	growth factor activity	IEA	molecular function
GO:0042742	defense response to bacterium	IEA	biological process
GO:0005355	glucose transmembrane transporter activity	TAS	molecular function
GO:1904659	glucose transmembrane transport	TAS	biological process
GO:0002576	platelet degranulation	TAS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0031093	platelet alpha granule lumen	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:1904724	tertiary granule lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04062	Chemokine signaling pathway
hsa04061	Viral protein interaction with cytokine and cytokine receptor

Diseases

Associated diseases	References
type 1 diabetes mellitus	PMID:14730686
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R