• Gene id: 54708

Gene Summary

• Gene Symbol: MARCHF5   Gene   UCSC   Ensembl
• Aliases: MARCH-V, MARCH5, MITOL, RNF153
• Gene name: membrane associated ring-CH-type finger 5
• Alternate names: E3 ubiquitin-protein ligase MARCHF5, E3 ubiquitin-protein ligase MARCH5, RING-type E3 ubiquitin transferase MARCH5, RING-type E3 ubiquitin transferase MARCHF5, membrane associated ring finger 5, membrane-associated RING finger protein 5, membrane-associated RIN,
• Gene location: 10q23.32-q23.33 (92291163: 92353963)     Exons: 7     NC_000010.11
• Gene summary(Entrez): MARCH5 is a ubiquitin ligase of the mitochondrial outer membrane that plays a role in the control of mitochondrial morphology by regulating mitofusin-2 (MFN2; MIM 608507) and DRP1 (DNM1L; MIM 603850) (Nakamura et al., 2006 [PubMed 16936636]).[supplied by
• OMIM: 610637

Protein Summary

• Protein general information: Q9NX47  
  • Name: E3 ubiquitin protein ligase MARCHF5 (EC 2.3.2.27) (Membrane associated RING finger protein 5) (Membrane associated RING CH protein V) (MARCH V) (Mitochondrial ubiquitin ligase) (MITOL) (RING finger protein 153) (RING type E3 ubiquitin transferase MARCHF5)
  • Length: 278  
  • Mass: 31232
  • Tissue specificity: Expressed in brain, heart, liver, lung, spleen, stomach, testis, skeletal and muscle. {ECO
• Sequence:

  MPDQALQQMLDRSCWVCFATDEDDRTAEWVRPCRCRGSTKWVHQACLQRWVDEKQRGNSTARVACPQCNAEYLIV
  FPKLGPVVYVLDLADRLISKACPFAAAGIMVGSIYWTAVTYGAVTVMQVVGHKEGLDVMERADPLFLLIGLPTIP
  VMLILGKMIRWEDYVLRLWRKYSNKLQILNSIFPGIGCPVPRIPAEANPLADHVSATRILCGALVFPTIATIVGK
  LMFSSVNSNLQRTILGGIAFVAIKGAFKVYFKQQQYLRQAHRKILNYPEQEEA

• Structural information:
  • Interpro: IPR011016  IPR013083  
  • Prosite: PS51292
  • STRING: ENSP00000351813
• Other Databases: GeneCards:  MARCHF5  Malacards:  MARCHF5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070585	protein localization to mitochondrion	IMP	biological process
GO:0051020	GTPase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005741	mitochondrial outer membrane	IDA	cellular component
GO:0005741	mitochondrial outer membrane	IDA	cellular component
GO:0000209	protein polyubiquitination	IDA	biological process
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0061630	ubiquitin protein ligase activity	IDA	molecular function
GO:0051865	protein autoubiquitination	IDA	biological process
GO:0016020	membrane	HDA	cellular component
GO:0090140	regulation of mitochondrial fission	IMP	biological process
GO:0090344	negative regulation of cell aging	IMP	biological process
GO:0061630	ubiquitin protein ligase activity	IMP	molecular function
GO:0090141	positive regulation of mitochondrial fission	IMP	biological process
GO:0090140	regulation of mitochondrial fission	IMP	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)