• Gene id: 5468

Gene Summary

• Gene Symbol: PPARG   Gene   UCSC   Ensembl
• Aliases: CIMT1, GLM1, NR1C3, PPARG1, PPARG2, PPARgamma
• Gene name: peroxisome proliferator activated receptor gamma
• Alternate names: peroxisome proliferator-activated receptor gamma, PPAR-gamma, nuclear receptor subfamily 1 group C member 3, peroxisome proliferator-activated nuclear receptor gamma variant 1,
• Gene location: 3p25.2 (12287484: 12471053)     Exons: 14     NC_000003.12
• Gene summary(Entrez): This gene encodes a member of the peroxisome proliferator-activated receptor (PPAR) subfamily of nuclear receptors. PPARs form heterodimers with retinoid X receptors (RXRs) and these heterodimers regulate transcription of various genes. Three subtypes of
• OMIM: 601487

Protein Summary

• Protein general information: P37231  
  • Name: Peroxisome proliferator activated receptor gamma (PPAR gamma) (Nuclear receptor subfamily 1 group C member 3)
  • Length: 505  
  • Mass: 57,620
• Sequence:

  MGETLGDSPIDPESDSFTDTLSANISQEMTMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSIST
  PHYEDIPFTRTDPVVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVCGDKASGFH
  YGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEI
  SSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQE
  QSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGF
  MTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLK
  LNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY

• Structural information:
  • Protein Domains: NR (238-503)
  • Interpro: IPR003074  IPR035500  IPR000536  IPR001723  IPR003077   IPR022590  IPR001628  IPR013088  
  • Prosite: PS51843 PS00031 PS51030
  • PDB: 1FM6 1FM9 1I7I 1K74 1KNU 1NYX 1PRG 1RDT 1WM0 1ZEO 1ZGY 2ATH 2F4B 2FVJ 2G0G 2G0H 2GTK 2HFP 2HWQ 2HWR 2I4J 2I4P 2I4Z 2OM9 2P4Y 2POB 2PRG 2Q59 2Q5P 2Q5S 2Q61 2Q6R 2Q6S 2Q8S 2QMV 2VSR 2VST 2VV0 2VV1 2VV2 2VV3 2VV4 2XKW 2YFE 2ZK0 2ZK1 2ZK2 2ZK3 2ZK4 2ZK5 2ZK6
  • PDBsum: 1FM6 1FM9 1I7I 1K74 1KNU 1NYX 1PRG 1RDT 1WM0 1ZEO 1ZGY 2ATH 2F4B 2FVJ 2G0G 2G0H 2GTK 2HFP 2HWQ 2HWR 2I4J 2I4P 2I4Z 2OM9 2P4Y 2POB 2PRG 2Q59 2Q5P 2Q5S 2Q61 2Q6R 2Q6S 2Q8S 2QMV 2VSR 2VST 2VV0 2VV1 2VV2 2VV3 2VV4 2XKW 2YFE 2ZK0 2ZK1 2ZK2 2ZK3 2ZK4 2ZK5 2ZK6
  • DIP: 35528
  • STRING: ENSP00000287820
• Other Databases: GeneCards:  PPARG  Malacards:  PPARG

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	ISS	biological process
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0001046	core promoter sequence-specific DNA binding	ISS	molecular function
GO:0001890	placenta development	ISS	biological process
GO:0002674	negative regulation of acute inflammatory response	IEA	biological process
GO:0003677	DNA binding	ISS	molecular function
GO:0003677	DNA binding	IDA	molecular function
GO:0003682	chromatin binding	ISS	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	ISS	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	IDA	molecular function
GO:0003707	steroid hormone receptor activity	IEA	molecular function
GO:0004879	RNA polymerase II transcription factor activity, ligand-activated sequence-specific DNA binding	IDA	molecular function
GO:0004955	prostaglandin receptor activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005829	cytosol	ISS	cellular component
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0006629	lipid metabolic process	TAS	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0007165	signal transduction	IDA	biological process
GO:0007186	G-protein coupled receptor signaling pathway	IEA	biological process
GO:0007507	heart development	IEA	biological process
GO:0007584	response to nutrient	TAS	biological process
GO:0008144	drug binding	IDA	molecular function
GO:0008144	drug binding	IDA	molecular function
GO:0008217	regulation of blood pressure	IMP	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0009409	response to cold	IEA	biological process
GO:0009612	response to mechanical stimulus	IEA	biological process
GO:0010745	negative regulation of macrophage derived foam cell differentiation	IC	biological process
GO:0010745	negative regulation of macrophage derived foam cell differentiation	IDA	biological process
GO:0010871	negative regulation of receptor biosynthetic process	IDA	biological process
GO:0010887	negative regulation of cholesterol storage	IDA	biological process
GO:0010891	negative regulation of sequestering of triglyceride	IDA	biological process
GO:0015909	long-chain fatty acid transport	ISS	biological process
GO:0019395	fatty acid oxidation	IEA	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0019903	protein phosphatase binding	IEA	molecular function
GO:0030224	monocyte differentiation	IDA	biological process
GO:0030308	negative regulation of cell growth	IEA	biological process
GO:0030331	estrogen receptor binding	IEA	molecular function
GO:0030374	ligand-dependent nuclear receptor transcription coactivator activity	IDA	molecular function
GO:0030855	epithelial cell differentiation	ISS	biological process
GO:0031000	response to caffeine	IEA	biological process
GO:0031100	animal organ regeneration	IEA	biological process
GO:0032526	response to retinoic acid	IDA	biological process
GO:0032869	cellular response to insulin stimulus	IMP	biological process
GO:0032966	negative regulation of collagen biosynthetic process	IEA	biological process
GO:0033189	response to vitamin A	IEA	biological process
GO:0033613	activating transcription factor binding	IDA	molecular function
GO:0033993	response to lipid	ISS	biological process
GO:0035357	peroxisome proliferator activated receptor signaling pathway	IMP	biological process
GO:0035902	response to immobilization stress	IEA	biological process
GO:0036270	response to diuretic	IEA	biological process
GO:0042593	glucose homeostasis	IMP	biological process
GO:0042594	response to starvation	IEA	biological process
GO:0042752	regulation of circadian rhythm	ISS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042953	lipoprotein transport	IDA	biological process
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0043401	steroid hormone mediated signaling pathway	IEA	biological process
GO:0043627	response to estrogen	IEA	biological process
GO:0044212	transcription regulatory region DNA binding	ISS	molecular function
GO:0044212	transcription regulatory region DNA binding	IDA	molecular function
GO:0045087	innate immune response	TAS	biological process
GO:0045165	cell fate commitment	ISS	biological process
GO:0045600	positive regulation of fat cell differentiation	ISS	biological process
GO:0045713	low-density lipoprotein particle receptor biosynthetic process	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	ISS	biological process
GO:0045893	positive regulation of transcription, DNA-templated	ISS	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IMP	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0046321	positive regulation of fatty acid oxidation	IEA	biological process
GO:0046965	retinoid X receptor binding	IDA	molecular function
GO:0048469	cell maturation	IDA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0048511	rhythmic process	IEA	biological process
GO:0048662	negative regulation of smooth muscle cell proliferation	IDA	biological process
GO:0048714	positive regulation of oligodendrocyte differentiation	IEA	biological process
GO:0050544	arachidonic acid binding	ISS	molecular function
GO:0050872	white fat cell differentiation	ISS	biological process
GO:0050872	white fat cell differentiation	TAS	biological process
GO:0051091	positive regulation of sequence-specific DNA binding transcription factor activity	IDA	biological process
GO:0051393	alpha-actinin binding	IPI	molecular function
GO:0051974	negative regulation of telomerase activity	IEA	biological process
GO:0055088	lipid homeostasis	TAS	biological process
GO:0055098	response to low-density lipoprotein particle	IDA	biological process
GO:0060100	positive regulation of phagocytosis, engulfment	IEA	biological process
GO:0060336	negative regulation of interferon-gamma-mediated signaling pathway	IMP	biological process
GO:0060694	regulation of cholesterol transporter activity	IC	biological process
GO:0060850	regulation of transcription involved in cell fate commitment	ISS	biological process
GO:0071300	cellular response to retinoic acid	IEA	biological process
GO:0071306	cellular response to vitamin E	IEA	biological process
GO:0071380	cellular response to prostaglandin E stimulus	IEA	biological process
GO:0071455	cellular response to hyperoxia	IEA	biological process
GO:0090575	RNA polymerase II transcription factor complex	IDA	cellular component
GO:1901558	response to metformin	IEA	biological process
GO:2000230	negative regulation of pancreatic stellate cell proliferation	IEA	biological process
GO:0043565	sequence-specific DNA binding	IDA	molecular function
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	ISS	biological process
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0001046	core promoter sequence-specific DNA binding	ISS	molecular function
GO:0001890	placenta development	ISS	biological process
GO:0002674	negative regulation of acute inflammatory response	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	ISS	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	IDA	molecular function
GO:0003682	chromatin binding	ISS	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	IEA	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	IEA	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	ISS	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	IDA	molecular function
GO:0003707	steroid hormone receptor activity	IEA	molecular function
GO:0004879	RNA polymerase II transcription factor activity, ligand-activated sequence-specific DNA binding	IEA	molecular function
GO:0004879	RNA polymerase II transcription factor activity, ligand-activated sequence-specific DNA binding	IDA	molecular function
GO:0004955	prostaglandin receptor activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	ISS	cellular component
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006357	regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0006629	lipid metabolic process	TAS	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0007165	signal transduction	IDA	biological process
GO:0007186	G-protein coupled receptor signaling pathway	IEA	biological process
GO:0007507	heart development	IEA	biological process
GO:0007584	response to nutrient	TAS	biological process
GO:0008134	transcription factor binding	IEA	molecular function
GO:0008144	drug binding	IDA	molecular function
GO:0008144	drug binding	IDA	molecular function
GO:0008217	regulation of blood pressure	IMP	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0008285	negative regulation of cell proliferation	IEA	biological process
GO:0009409	response to cold	IEA	biological process
GO:0009612	response to mechanical stimulus	IEA	biological process
GO:0010033	response to organic substance	IEA	biological process
GO:0010745	negative regulation of macrophage derived foam cell differentiation	IC	biological process
GO:0010745	negative regulation of macrophage derived foam cell differentiation	IDA	biological process
GO:0010871	negative regulation of receptor biosynthetic process	IDA	biological process
GO:0010887	negative regulation of cholesterol storage	IDA	biological process
GO:0010891	negative regulation of sequestering of triglyceride	IDA	biological process
GO:0014070	response to organic cyclic compound	IEA	biological process
GO:0015909	long-chain fatty acid transport	ISS	biological process
GO:0019216	regulation of lipid metabolic process	IEA	biological process
GO:0019395	fatty acid oxidation	IEA	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0019903	protein phosphatase binding	IEA	molecular function
GO:0030224	monocyte differentiation	IDA	biological process
GO:0030308	negative regulation of cell growth	IEA	biological process
GO:0030331	estrogen receptor binding	IEA	molecular function
GO:0030374	ligand-dependent nuclear receptor transcription coactivator activity	IDA	molecular function
GO:0030855	epithelial cell differentiation	ISS	biological process
GO:0031000	response to caffeine	IEA	biological process
GO:0031100	animal organ regeneration	IEA	biological process
GO:0032526	response to retinoic acid	IDA	biological process
GO:0032869	cellular response to insulin stimulus	IMP	biological process
GO:0032966	negative regulation of collagen biosynthetic process	IEA	biological process
GO:0033189	response to vitamin A	IEA	biological process
GO:0033613	activating transcription factor binding	IDA	molecular function
GO:0033993	response to lipid	IEA	biological process
GO:0033993	response to lipid	ISS	biological process
GO:0035357	peroxisome proliferator activated receptor signaling pathway	IMP	biological process
GO:0035902	response to immobilization stress	IEA	biological process
GO:0036270	response to diuretic	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0042593	glucose homeostasis	IMP	biological process
GO:0042594	response to starvation	IEA	biological process
GO:0042752	regulation of circadian rhythm	ISS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042953	lipoprotein transport	IDA	biological process
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0043401	steroid hormone mediated signaling pathway	IEA	biological process
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0043627	response to estrogen	IEA	biological process
GO:0044212	transcription regulatory region DNA binding	IEA	molecular function
GO:0044212	transcription regulatory region DNA binding	ISS	molecular function
GO:0044212	transcription regulatory region DNA binding	IDA	molecular function
GO:0045087	innate immune response	TAS	biological process
GO:0045165	cell fate commitment	ISS	biological process
GO:0045598	regulation of fat cell differentiation	IEA	biological process
GO:0045600	positive regulation of fat cell differentiation	ISS	biological process
GO:0045713	low-density lipoprotein particle receptor biosynthetic process	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	ISS	biological process
GO:0045893	positive regulation of transcription, DNA-templated	ISS	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IMP	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0046321	positive regulation of fatty acid oxidation	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0046965	retinoid X receptor binding	IDA	molecular function
GO:0048469	cell maturation	IDA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0048511	rhythmic process	IEA	biological process
GO:0048662	negative regulation of smooth muscle cell proliferation	IDA	biological process
GO:0048714	positive regulation of oligodendrocyte differentiation	IEA	biological process
GO:0050544	arachidonic acid binding	ISS	molecular function
GO:0050872	white fat cell differentiation	ISS	biological process
GO:0050872	white fat cell differentiation	TAS	biological process
GO:0051091	positive regulation of sequence-specific DNA binding transcription factor activity	IDA	biological process
GO:0051393	alpha-actinin binding	IPI	molecular function
GO:0051974	negative regulation of telomerase activity	IEA	biological process
GO:0055088	lipid homeostasis	TAS	biological process
GO:0055098	response to low-density lipoprotein particle	IDA	biological process
GO:0060100	positive regulation of phagocytosis, engulfment	IEA	biological process
GO:0060336	negative regulation of interferon-gamma-mediated signaling pathway	IMP	biological process
GO:0060694	regulation of cholesterol transporter activity	IC	biological process
GO:0060850	regulation of transcription involved in cell fate commitment	ISS	biological process
GO:0071300	cellular response to retinoic acid	IEA	biological process
GO:0071306	cellular response to vitamin E	IEA	biological process
GO:0071379	cellular response to prostaglandin stimulus	IEA	biological process
GO:0071380	cellular response to prostaglandin E stimulus	IEA	biological process
GO:0071455	cellular response to hyperoxia	IEA	biological process
GO:0090575	RNA polymerase II transcription factor complex	IDA	cellular component
GO:1901558	response to metformin	IEA	biological process
GO:2000230	negative regulation of pancreatic stellate cell proliferation	IEA	biological process
GO:0043565	sequence-specific DNA binding	IDA	molecular function
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	ISS	biological process
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0001046	core promoter sequence-specific DNA binding	ISS	molecular function
GO:0001890	placenta development	ISS	biological process
GO:0003677	DNA binding	ISS	molecular function
GO:0003677	DNA binding	IDA	molecular function
GO:0003682	chromatin binding	ISS	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	ISS	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	IDA	molecular function
GO:0004879	RNA polymerase II transcription factor activity, ligand-activated sequence-specific DNA binding	IDA	molecular function
GO:0004955	prostaglandin receptor activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005829	cytosol	ISS	cellular component
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0006629	lipid metabolic process	TAS	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0007165	signal transduction	IDA	biological process
GO:0007584	response to nutrient	TAS	biological process
GO:0008144	drug binding	IDA	molecular function
GO:0008144	drug binding	IDA	molecular function
GO:0008217	regulation of blood pressure	IMP	biological process
GO:0010745	negative regulation of macrophage derived foam cell differentiation	IC	biological process
GO:0010745	negative regulation of macrophage derived foam cell differentiation	IDA	biological process
GO:0010871	negative regulation of receptor biosynthetic process	IDA	biological process
GO:0010887	negative regulation of cholesterol storage	IDA	biological process
GO:0010891	negative regulation of sequestering of triglyceride	IDA	biological process
GO:0015909	long-chain fatty acid transport	ISS	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0030224	monocyte differentiation	IDA	biological process
GO:0030374	ligand-dependent nuclear receptor transcription coactivator activity	IDA	molecular function
GO:0030855	epithelial cell differentiation	ISS	biological process
GO:0032526	response to retinoic acid	IDA	biological process
GO:0032869	cellular response to insulin stimulus	IMP	biological process
GO:0033613	activating transcription factor binding	IDA	molecular function
GO:0033993	response to lipid	ISS	biological process
GO:0035357	peroxisome proliferator activated receptor signaling pathway	IMP	biological process
GO:0042593	glucose homeostasis	IMP	biological process
GO:0042752	regulation of circadian rhythm	ISS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042953	lipoprotein transport	IDA	biological process
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0044212	transcription regulatory region DNA binding	ISS	molecular function
GO:0044212	transcription regulatory region DNA binding	IDA	molecular function
GO:0045087	innate immune response	TAS	biological process
GO:0045165	cell fate commitment	ISS	biological process
GO:0045600	positive regulation of fat cell differentiation	ISS	biological process
GO:0045713	low-density lipoprotein particle receptor biosynthetic process	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	ISS	biological process
GO:0045893	positive regulation of transcription, DNA-templated	ISS	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IMP	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0046965	retinoid X receptor binding	IDA	molecular function
GO:0048469	cell maturation	IDA	biological process
GO:0048662	negative regulation of smooth muscle cell proliferation	IDA	biological process
GO:0050544	arachidonic acid binding	ISS	molecular function
GO:0050872	white fat cell differentiation	ISS	biological process
GO:0050872	white fat cell differentiation	TAS	biological process
GO:0051091	positive regulation of sequence-specific DNA binding transcription factor activity	IDA	biological process
GO:0051393	alpha-actinin binding	IPI	molecular function
GO:0055088	lipid homeostasis	TAS	biological process
GO:0055098	response to low-density lipoprotein particle	IDA	biological process
GO:0060336	negative regulation of interferon-gamma-mediated signaling pathway	IMP	biological process
GO:0060694	regulation of cholesterol transporter activity	IC	biological process
GO:0060850	regulation of transcription involved in cell fate commitment	ISS	biological process
GO:0090575	RNA polymerase II transcription factor complex	IDA	cellular component
GO:0043565	sequence-specific DNA binding	IDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04152	AMPK signaling pathway
hsa03320	PPAR signaling pathway
hsa04380	Osteoclast differentiation
hsa04211	Longevity regulating pathway
hsa04714	Thermogenesis
hsa05200	Pathways in cancer
hsa05202	Transcriptional misregulation in cancer
hsa05216	Thyroid cancer
hsa05016	Huntington disease

Diseases

Associated diseases	References
Leiomyomatosis	INFBASE: 16725353
Cancer (thyroid)	KEGG: H00032
Cancer	GAD: 20596649
Cancer (Adenocarcinoma)	GAD: 18372284
Cancer (Adenoma)	GAD: 15564289
Cancer (Biliary tract neoplasms)	GAD: 18676870
Cancer (bladder)	GAD: 16110031
Cancer (colon)	GAD: 18992263
Cancer (colorectal)	GAD: 16141797
Cancer (epithelial ovarian)	GAD: 19064572
Cancer (esophageal)	GAD: 18398047
Cancer (lung)	GAD: 14604894
Cancer (melanoma)	GAD: 16713673
Cancer (myeloma)	GAD: 18997828
Cancer (non-Hodgkin lymphoma)	GAD: 16543247
Cancer (non-melanoma skin cancer)	GAD: 17307204
Cancer (pancreatic)	GAD: 19436234
Cancer (prostate)	GAD: 12609711
Cancer (thyroid)	GAD: 19730683
Cancer (breast)	GAD: 12439219
Angina pectoris	GAD: 17892998
Apoplexy	GAD: 17359638
Atherosclerosis	GAD: 15356014
Brain ischemia	GAD: 18561518
Hypertension	GAD: 12544508
Cardiovascular disease	GAD: 15699916
Carotid artery diseases	GAD: 15144586
Carotid artery diseases	OMIM: 601487
Left ventricular hypertrophy	GAD: 15649578
Restenosis	GAD: 12082592
Ventricular dysfunction	GAD: 20426853
Hyperandrogenism	GAD: 16541712
Graves disease	GAD: 18624999
Hodgkin disease	GAD: 21061265
Asthma	GAD: 19217272
Inflammation	GAD: 18680073
Inflammatory bowel disease	GAD: 19104705
Ulcerative colitis	GAD: 18507082
Rheumatoid arthritis	GAD: 19199260
Multiple sclerosis	GAD: 18977277
Psoriasis	GAD: 15083308
Systemic lupus erythematosus (SLE)	GAD: 15934434
Chronic ulcerative colitis	GAD: 20392673
Crohn's disease	GAD: 20650551
Fatty liver	GAD: 19208777
Hyperlipidemia	GAD: 14680975
Hypercholesterolemia	GAD: 20413122
Metabolic syndrome	GAD: 16186413
Hypertriglyceridemia	GAD: 16630553
Hyperglycemia	GAD: 16567542
Diabetes	KEGG: H00409
Insulin resistance	OMIM: 601487
Obesity	OMIM: 601487
Diabetes	GAD: 601487
Hyperinsulinism	GAD: 20606394
Dyslipidemias	GAD: 20388362
Bone diseases	GAD: 10381354
Osteoporosis	GAD: 19727905
Alzheimer's disease	GAD: 17440948
Amyotrophic lateral sclerosis (ALS)	GAD: 18513389
Hearing Loss	GAD: 19898482
Bulimia	GAD: 20468064
Psychological disorders	GAD: 19766907
Schizophrenia	GAD: 19193342
Cognitive function	GAD: 18639367
Depression	GAD: 19766907
Kidney diseases	GAD: 19578796
Chronic renal failure	GAD: 21085059
Preeclampsia	GAD: 12324185
Adenomyosis	INFBASE: 16725353
Functional ovarian hyperandrogenism	INFBASE: 16541712
Endometriosis	INFBASE: 19074548
Miscarriage	INFBASE: 19342081
Improves chances of IVF success	INFBASE: 21764381
Polycystic ovary syndrome (PCOS)	INFBASE: 23748472
Fertilizing defects	INFBASE: 21764381
Fertilizing defects	MIK: 18443916
Chorioamnionitis	GAD: 20452482
Endometriosis	INFBASE: 16725353
Chronic obstructive pulmonary disease (COPD)	GAD: 19625176
Wegener granulomatosis	GAD: 19223982
Familial partial lipodystrophy	KEGG: H00420
Lipodystrophy	OMIM: 601487
Albuminuria	GAD: 17681394
Calcinosis	GAD: 20616309
Growth disorders	GAD: 19808901
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Fertility	MIK: 18443916
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
18443916	Fertility	PPAR-gamma Pro/Ala, APOE*2 allele		151 healthy unrelated subjects	Male infertility	APOE  PPAR-gamma
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray