• Gene id: 5467

Gene Summary

• Gene Symbol: PPARD   Gene   UCSC   Ensembl
• Aliases: FAAR, NR1C2, NUC1, NUCI, NUCII, PPARB
• Gene name: peroxisome proliferator activated receptor delta
• Alternate names: peroxisome proliferator-activated receptor delta, PPAR-beta, PPAR-delta, PPARD/MYO1D fusion, nuclear hormone receptor 1, nuclear receptor subfamily 1 group C member 2, peroxisome proliferator-activated receptor beta,
• Gene location: 6p21.31 (17951301: 17999120)     Exons: 14     NC_000019.10
• Gene summary(Entrez): This gene encodes a member of the peroxisome proliferator-activated receptor (PPAR) family. The encoded protein is thought to function as an integrator of transcriptional repression and nuclear receptor signaling. It may inhibit the ligand-induced transcr
• OMIM: 600409

Protein Summary

• Protein general information: Q03181  
  • Name: Peroxisome proliferator activated receptor delta (PPAR delta) (NUCI) (Nuclear hormone receptor 1) (NUC1) (Nuclear receptor subfamily 1 group C member 2) (Peroxisome proliferator activated receptor beta) (PPAR beta)
  • Length: 441  
  • Mass: 49903
  • Tissue specificity: Ubiquitous with maximal levels in placenta and skeletal muscle.
• Sequence:

  MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSSPPSLLDQLQMGCDGASCGSLNMECR
  VCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKKNRNKCQYCRFQKCLALGMSHNAIRFGRMPE
  AEKRKLVAGLTANEGSQYNPQVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKG
  LVWKQLVNGLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNK
  DGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQD
  TILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY

• Structural information:
  • Protein Domains: (211..43-)
    (/note="NR-LBD)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01189"-)
  • Interpro: IPR003074  IPR003075  IPR035500  IPR000536  IPR001723   IPR001628  IPR013088  
  • Prosite: PS51843 PS00031 PS51030
  • PDB: 1GWX 1Y0S 2AWH 2B50 2BAW 2ENV 2GWX 2J14 2Q5G 2XYJ 2XYW 2XYX 2ZNP 2ZNQ 3D5F 3DY6 3ET2 3GWX 3GZ9 3OZ0 3PEQ 3SP9 3TKM 5U3Q 5U3R 5U3S 5U3T 5U3U 5U3V 5U3W 5U3X 5U3Y 5U3Z 5U40 5U41 5U42 5U43 5U44 5U45 5U46 5XMX 5Y7X 5ZXI 6A6P
  • PDBsum: 1GWX 1Y0S 2AWH 2B50 2BAW 2ENV 2GWX 2J14 2Q5G 2XYJ 2XYW 2XYX 2ZNP 2ZNQ 3D5F 3DY6 3ET2 3GWX 3GZ9 3OZ0 3PEQ 3SP9 3TKM 5U3Q 5U3R 5U3S 5U3T 5U3U 5U3V 5U3W 5U3X 5U3Y 5U3Z 5U40 5U41 5U42 5U43 5U44 5U45 5U46 5XMX 5Y7X 5ZXI 6A6P
  • STRING: ENSP00000310928
• Other Databases: GeneCards:  PPARD  Malacards:  PPARD

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0006915	apoptotic process	IMP	biological process
GO:0004879	nuclear receptor activity	IBA	molecular function
GO:0009755	hormone-mediated signaling pathway	IBA	biological process
GO:0019216	regulation of lipid metabolic process	IBA	biological process
GO:0030154	cell differentiation	IBA	biological process
GO:0033993	response to lipid	IBA	biological process
GO:0038023	signaling receptor activity	IBA	molecular function
GO:0090575	RNA polymerase II transcription regulator complex	IBA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IBA	biological process
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0001103	RNA polymerase II repressing transcription factor binding	IBA	molecular function
GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific	IBA	molecular function
GO:0006631	fatty acid metabolic process	IBA	biological process
GO:0008134	transcription factor binding	IBA	molecular function
GO:0010887	negative regulation of cholesterol storage	IBA	biological process
GO:0045923	positive regulation of fatty acid metabolic process	IBA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0050728	negative regulation of inflammatory response	IBA	biological process
GO:0008289	lipid binding	IDA	molecular function
GO:0004879	nuclear receptor activity	IDA	molecular function
GO:0003700	DNA-binding transcription factor activity	IDA	molecular function
GO:0070539	linoleic acid binding	IDA	molecular function
GO:0008144	drug binding	IDA	molecular function
GO:0008134	transcription factor binding	IPI	molecular function
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0003707	steroid hormone receptor activity	IEA	molecular function
GO:0004879	nuclear receptor activity	IEA	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0042025	host cell nucleus	IEA	cellular component
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003707	steroid hormone receptor activity	TAS	molecular function
GO:0006629	lipid metabolic process	TAS	biological process
GO:0006091	generation of precursor metabolites and energy	TAS	biological process
GO:0006357	regulation of transcription by RNA polymerase II	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0097755	positive regulation of blood vessel diameter	IEA	biological process
GO:0071222	cellular response to lipopolysaccharide	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0032966	negative regulation of collagen biosynthetic process	IEA	biological process
GO:0030308	negative regulation of cell growth	IEA	biological process
GO:0014912	negative regulation of smooth muscle cell migration	IEA	biological process
GO:0014823	response to activity	IEA	biological process
GO:0010033	response to organic substance	IEA	biological process
GO:0009749	response to glucose	IEA	biological process
GO:0007566	embryo implantation	IEA	biological process
GO:0005504	fatty acid binding	IEA	molecular function
GO:1902894	negative regulation of pri-miRNA transcription by RNA polymerase II	IEA	biological process
GO:0071456	cellular response to hypoxia	IEA	biological process
GO:0060612	adipose tissue development	IEA	biological process
GO:0051546	keratinocyte migration	IEA	biological process
GO:0050680	negative regulation of epithelial cell proliferation	IEA	biological process
GO:0045662	negative regulation of myoblast differentiation	IEA	biological process
GO:0043616	keratinocyte proliferation	IEA	biological process
GO:0043415	positive regulation of skeletal muscle tissue regeneration	IEA	biological process
GO:0042127	regulation of cell population proliferation	IEA	biological process
GO:0042060	wound healing	IEA	biological process
GO:0031589	cell-substrate adhesion	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0015908	fatty acid transport	IEA	biological process
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	IEA	biological process
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0008366	axon ensheathment	IEA	biological process
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0007566	embryo implantation	IEA	biological process
GO:0006635	fatty acid beta-oxidation	IEA	biological process
GO:0001890	placenta development	IEA	biological process
GO:0051059	NF-kappaB binding	IEA	molecular function
GO:0050728	negative regulation of inflammatory response	IEA	biological process
GO:0048662	negative regulation of smooth muscle cell proliferation	IEA	biological process
GO:0046697	decidualization	IEA	biological process
GO:0045684	positive regulation of epidermis development	IEA	biological process
GO:0033189	response to vitamin A	IEA	biological process
GO:0032024	positive regulation of insulin secretion	IEA	biological process
GO:0019395	fatty acid oxidation	IEA	biological process
GO:0009299	mRNA transcription	IEA	biological process
GO:0008654	phospholipid biosynthetic process	IEA	biological process
GO:0007507	heart development	IEA	biological process
GO:0006776	vitamin A metabolic process	IEA	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0006029	proteoglycan metabolic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003713	transcription coactivator activity	IEA	molecular function
GO:2000288	positive regulation of myoblast proliferation	IEA	biological process
GO:0045598	regulation of fat cell differentiation	IEA	biological process
GO:0014842	regulation of skeletal muscle satellite cell proliferation	IEA	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA	molecular function
GO:0000790	nuclear chromatin	IEA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0008144	drug binding	IDA	molecular function
GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific	ISS	molecular function
GO:1902894	negative regulation of pri-miRNA transcription by RNA polymerase II	ISS	biological process
GO:0000790	nuclear chromatin	ISS	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0043401	steroid hormone mediated signaling pathway	IEA	biological process
GO:0043401	steroid hormone mediated signaling pathway	IEA	biological process
GO:0030522	intracellular receptor signaling pathway	IEA	biological process
GO:0030522	intracellular receptor signaling pathway	IEA	biological process
GO:0030522	intracellular receptor signaling pathway	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0003700	DNA-binding transcription factor activity	IDA	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	ISS	biological process
GO:0009062	fatty acid catabolic process	TAS	biological process
GO:0006635	fatty acid beta-oxidation	TAS	biological process
GO:1904659	glucose transmembrane transport	NAS	biological process
GO:0008283	cell population proliferation	ISS	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	ISS	biological process
GO:0097190	apoptotic signaling pathway	IMP	biological process
GO:0045600	positive regulation of fat cell differentiation	NAS	biological process
GO:0015908	fatty acid transport	ISS	biological process
GO:0008366	axon ensheathment	ISS	biological process
GO:0007566	embryo implantation	TAS	biological process
GO:0006635	fatty acid beta-oxidation	TAS	biological process
GO:0006635	fatty acid beta-oxidation	ISS	biological process
GO:0006006	glucose metabolic process	NAS	biological process
GO:0003700	DNA-binding transcription factor activity	NAS	molecular function
GO:0046697	decidualization	TAS	biological process
GO:0008203	cholesterol metabolic process	TAS	biological process
GO:0006629	lipid metabolic process	ISS	biological process
GO:0005634	nucleus	NAS	cellular component
GO:0003677	DNA binding	ISS	molecular function
GO:0001223	transcription coactivator binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04310	Wnt signaling pathway
hsa03320	PPAR signaling pathway
hsa05221	Acute myeloid leukemia

Diseases

Associated diseases	References
pancreatic cancer	PMID:17652168
biliary tract cancer	PMID:18497548
type 2 diabetes mellitus	PMID:16804087
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq