• Gene id: 54664

Gene Summary

• Gene Symbol: TMEM106B   Gene   UCSC   Ensembl
• Aliases: HLD16
• Gene name: transmembrane protein 106B
• Alternate names: transmembrane protein 106B,
• Gene location: 7p21.3 (12211293: 12243366)     Exons: 9     NC_000007.14
• OMIM: 613413

Protein Summary

• Protein general information: Q9NUM4  
  • Name: Transmembrane protein 106B
  • Length: 274  
  • Mass: 31127
  • Tissue specificity: Expressed in frontal cortex.
• Sequence:

  MGKSLSHLPLHSSKEDAYDGVTSENMRNGLVNSEVHNEDGRNGDVSQFPYVEFTGRDSVTCPTCQGTGRIPRGQE
  NQLVALIPYSDQRLRPRRTKLYVMASVFVCLLLSGLAVFFLFPRSIDVKYIGVKSAYVSYDVQKRTIYLNITNTL
  NITNNNYYSVEVENITAQVQFSKTVIGKARLNNITIIGPLDMKQIDYTVPTVIAEEMSYMYDFCTLISIKVHNIV
  LMMQVTVTTTYFGHSEQISQERYQYVDCGRNTTYQLGQSEYLNVLQPQQ

• Structural information:
  • Interpro: IPR009790  
  • STRING: ENSP00000379901
• Other Databases: GeneCards:  TMEM106B  Malacards:  TMEM106B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0048813	dendrite morphogenesis	IBA	biological process
GO:0032418	lysosome localization	IBA	biological process
GO:0007040	lysosome organization	IBA	biological process
GO:0005765	lysosomal membrane	IBA	cellular component
GO:0007041	lysosomal transport	IBA	biological process
GO:0005765	lysosomal membrane	IDA	cellular component
GO:0048813	dendrite morphogenesis	IMP	biological process
GO:0032418	lysosome localization	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005764	lysosome	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005764	lysosome	IEA	cellular component
GO:0007040	lysosome organization	IEA	biological process
GO:1900006	positive regulation of dendrite development	IEA	biological process
GO:0007041	lysosomal transport	IEA	biological process
GO:0031902	late endosome membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0005764	lysosome	IDA	cellular component
GO:0005768	endosome	IDA	cellular component
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray