• Gene id: 54663

Gene Summary

• Gene Symbol: WDR74   Gene   UCSC   Ensembl
• Aliases: Nsa1
• Gene name: WD repeat domain 74
• Alternate names: WD repeat-containing protein 74, NOP seven-associated protein 1,
• Gene location: 11q12.3 (62841808: 62832904)     Exons: 15     NC_000011.10
• OMIM: 617947

Protein Summary

• Protein general information: Q6RFH5  
  • Name: WD repeat containing protein 74 (NOP seven associated protein 1)
  • Length: 385  
  • Mass: 42441
• Sequence:

  MAAAAARWNHVWVGTETGILKGVNLQRKQAANFTAGGQPRREEAVSALCWGTGGETQMLVGCADRTVKHFSTEDG
  IFQGQRHCPGGEGMFRGLAQADGTLITCVDSGILRVWHDKDKDTSSDPLLELRVGPGVCRMRQDPAHPHVVATGG
  KENALKIWDLQGSEEPVFRAKNVRNDWLDLRVPIWDQDIQFLPGSQKLVTCTGYHQVRVYDPASPQRRPVLETTY
  GEYPLTAMTLTPGGNSVIVGNTHGQLAEIDLRQGRLLGCLKGLAGSVRGLQCHPSKPLLASCGLDRVLRIHRIQN
  PRGLEHKVYLKSQLNCLLLSGRDNWEDEPQEPQEPNKVPLEDTETDELWASLEAAAKRKLSGLEQPQGALQTRRR
  KKKRPGSTSP

• Structural information:
  • Interpro: IPR015943  IPR001680  IPR036322  IPR037379  
  • STRING: ENSP00000432119
• Other Databases: GeneCards:  WDR74  Malacards:  WDR74

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005730	nucleolus	IBA	cellular component
GO:0030687	preribosome, large subunit precursor	IBA	cellular component
GO:0042273	ribosomal large subunit biogenesis	IBA	biological process
GO:0005730	nucleolus	IDA	colocalizes with
GO:0000176	nuclear exosome (RNase complex)	IDA	colocalizes with
GO:0005730	nucleolus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0042273	ribosomal large subunit biogenesis	IMP	biological process
GO:0016070	RNA metabolic process	ISS	biological process
GO:0001825	blastocyst formation	ISS	biological process
GO:0005730	nucleolus	IMP	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0006364	rRNA processing	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0042273	ribosomal large subunit biogenesis	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0016070	RNA metabolic process	IEA	biological process
GO:0001825	blastocyst formation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)