• Gene id: 54617

Gene Summary

• Gene Symbol: INO80   Gene   UCSC   Ensembl
• Aliases: INO80A, INOC1
• Gene name: INO80 complex ATPase subunit
• Alternate names: chromatin-remodeling ATPase INO80, DNA helicase INO80, DNA helicase-related INO80 complex homolog 1, DNA helicase-related protein INO80, INO80 complex subunit A, homolog of yeast INO80, putative DNA helicase INO80 complex homolog 1,
• Gene location: 15q15.1 (41117777: 40978879)     Exons: 37     NC_000015.10
• Gene summary(Entrez): This gene encodes a subunit of the chromatin remodeling complex, which is classified into subfamilies depending on sequence features apart from the conserved ATPase domain. This protein is the catalytic ATPase subunit of the INO80 chromatin remodeling com
• OMIM: 104250

Protein Summary

• Protein general information: Q9ULG1  
  • Name: Chromatin remodeling ATPase INO80 (hINO80) (EC 3.6.4. ) (DNA helicase related INO80 complex homolog 1) (DNA helicase related protein INO80) (INO80 complex subunit A)
  • Length: 1556  
  • Mass: 176753
  • Tissue specificity: According to PubMed
• Sequence:

  MASELGARDDGGCTELAKPLYLQYLERALRLDHFLRQTSAIFNRNISSDDSEDGLDDSNPLLPQSGDPLIQVKEE
  PPNSLLGETSGAGSSGMLNTYSLNGVLQSESKCDKGNLYNFSKLKKSRKWLKSILLSDESSEADSQSEDDDEEEL
  NLSREELHNMLRLHKYKKLHQNKYSKDKELQQYQYYSAGLLSTYDPFYEQQRHLLGPKKKKFKEEKKLKAKLKKV
  KKKRRRDEELSSEESPRRHHHQTKVFAKFSHDAPPPGTKKKHLSIEQLNARRRKVWLSIVKKELPKANKQKASAR
  NLFLTNSRKLAHQCMKEVRRAALQAQKNCKETLPRARRLTKEMLLYWKKYEKVEKEHRKRAEKEALEQRKLDEEM
  REAKRQQRKLNFLITQTELYAHFMSRKRDMGHDGIQEEILRKLEDSSTQRQIDIGGGVVVNITQEDYDSNHFKAQ
  ALKNAENAYHIHQARTRSFDEDAKESRAAALRAANKSGTGFGESYSLANPSIRAGEDIPQPTIFNGKLKGYQLKG
  MNWLANLYEQGINGILADEMGLGKTVQSIALLAHLAERENIWGPFLIISPASTLNNWHQEFTRFVPKFKVLPYWG
  NPHDRKVIRRFWSQKTLYTQDAPFHVVITSYQLVVQDVKYFQRVKWQYMVLDEAQALKSSSSVRWKILLQFQCRN
  RLLLTGTPIQNTMAELWALLHFIMPTLFDSHEEFNEWFSKDIESHAENKSAIDENQLSRLHMILKPFMLRRIKKD
  VENELSDKIEILMYCQLTSRQKLLYQALKNKISIEDLLQSSMGSTQQAQNTTSSLMNLVMQFRKVCNHPELFERQ
  ETWSPFHISLKPYHISKFIYRHGQIRVFNHSRDRWLRVLSPFAPDYIQRSLFHRKGINEESCFSFLRFIDISPAE
  MANLMLQGLLARWLALFLSLKASYRLHQLRSWGAPEGESHQRYLRNKDFLLGVNFPLSFPNLCSCPLLKSLVFSS
  HCKAVSGYSDQVVHQRRSATSSLRRCLLTELPSFLCVASPRVTAVPLDSYCNDRSAEYERRVLKEGGSLAAKQCL
  LNGAPELAADWLNRRSQFFPEPAGGLWSIRPQNGWSFIRIPGKESLITDSGKLYALDVLLTRLKSQGHRVLIYSQ
  MTRMIDLLEEYMVYRKHTYMRLDGSSKISERRDMVADFQNRNDIFVFLLSTRAGGLGINLTAADTVIFYDSDWNP
  TVDQQAMDRAHRLGQTKQVTVYRLICKGTIEERILQRAKEKSEIQRMVISGGNFKPDTLKPKEVVSLLLDDEELE
  KKLRLRQEEKRQQEETNRVKERKRKREKYAEKKKKEDELDGKRRKEGVNLVIPFVPSADNSNLSADGDDSFISVD
  SAMPSPFSEISISSELHTGSIPLDESSSDMLVIVDDPASSAPQSRATNSPASITGSVSDTVNGISIQEMPAAGRG
  HSARSRGRPKGSGSTAKGAGKGRSRKSTAGSAAAMAGAKAGAAAASAAAYAAYGYNVSKGISASSPLQTSLVRPA
  GLADFGPSSASSPLSSPLSKGNNVPGNPKNLHMTSSLAPDSLVRKQGKGTNPSGGR

• Structural information:
  • Protein Domains: (280..40-)
    (/note="DBINO-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00746-)
    (530..70-)
    (/note="Helicase-ATP-binding)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00541-)
    (1105..126-)
    (/note="Helicase-C-terminal)
    (/evidence="ECO:0000255-)
  • Interpro: IPR020838  IPR014001  IPR001650  IPR031047  IPR027417   IPR038718  IPR000330  
  • Prosite: PS51413 PS51192 PS51194
  • PDB: 6HTS
  • PDBsum: 6HTS
  • DIP: 34296
  • STRING: ENSP00000355205
• Other Databases: GeneCards:  INO80  Malacards:  INO80

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006281	DNA repair	IBA	biological process
GO:0042393	histone binding	IBA	molecular function
GO:0043618	regulation of transcription from RNA polymerase II promoter in response to stress	IBA	biological process
GO:0006338	chromatin remodeling	IBA	biological process
GO:0016887	ATPase activity	IBA	molecular function
GO:0031011	Ino80 complex	IBA	cellular component
GO:0042766	nucleosome mobilization	IBA	biological process
GO:0043044	ATP-dependent chromatin remodeling	IBA	biological process
GO:0031011	Ino80 complex	IDA	cellular component
GO:0031011	Ino80 complex	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:2000045	regulation of G1/S transition of mitotic cell cycle	IMP	biological process
GO:0010571	positive regulation of nuclear cell cycle DNA replication	IMP	biological process
GO:0071479	cellular response to ionizing radiation	IMP	biological process
GO:0070914	UV-damage excision repair	IMP	biological process
GO:0051225	spindle assembly	IMP	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:0043014	alpha-tubulin binding	IMP	molecular function
GO:0034644	cellular response to UV	IMP	biological process
GO:0030307	positive regulation of cell growth	IMP	biological process
GO:0006302	double-strand break repair	IMP	biological process
GO:0000724	double-strand break repair via homologous recombination	IMP	biological process
GO:0000070	mitotic sister chromatid segregation	IMP	biological process
GO:0006281	DNA repair	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006338	chromatin remodeling	IEA	biological process
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0016887	ATPase activity	IEA	molecular function
GO:0031011	Ino80 complex	IEA	cellular component
GO:0051301	cell division	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0003779	actin binding	IEA	molecular function
GO:0006281	DNA repair	IEA	biological process
GO:0005694	chromosome	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0006310	DNA recombination	IEA	biological process
GO:0005874	microtubule	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0016579	protein deubiquitination	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0003677	DNA binding	IDA	molecular function
GO:0008094	DNA-dependent ATPase activity	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0006338	chromatin remodeling	ISS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881