• Gene id: 54606

Gene Summary

• Gene Symbol: DDX56   Gene   UCSC   Ensembl
• Aliases: DDX21, DDX26, NOH61
• Gene name: DEAD-box helicase 56
• Alternate names: probable ATP-dependent RNA helicase DDX56, 61-kd nucleolar helicase, ATP-dependent 61 kDa nucleolar RNA helicase, DEAD (Asp-Glu-Ala-Asp) box helicase 56, DEAD (Asp-Glu-Ala-Asp) box polypeptide 56, DEAD box protein 21, DEAD box protein 56, DEAD-box RNA helicase, n,
• Gene location: 7p13 (44574537: 44565416)     Exons: 14     NC_000007.14
• Gene summary(Entrez): This gene encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA second
• OMIM: 603236

Protein Summary

• Protein general information: Q9NY93  
  • Name: Probable ATP dependent RNA helicase DDX56 (EC 3.6.4.13) (ATP dependent 61 kDa nucleolar RNA helicase) (DEAD box protein 21) (DEAD box protein 56)
  • Length: 547  
  • Mass: 61590
  • Tissue specificity: Detected in heart, brain, liver, pancreas, placenta and lung.
• Sequence:

  MEDSEALGFEHMGLDPRLLQAVTDLGWSRPTLIQEKAIPLALEGKDLLARARTGSGKTAAYAIPMLQLLLHRKAT
  GPVVEQAVRGLVLVPTKELARQAQSMIQQLATYCARDVRVANVSAAEDSVSQRAVLMEKPDVVVGTPSRILSHLQ
  QDSLKLRDSLELLVVDEADLLFSFGFEEELKSLLCHLPRIYQAFLMSATFNEDVQALKELILHNPVTLKLQESQL
  PGPDQLQQFQVVCETEEDKFLLLYALLKLSLIRGKSLLFVNTLERSYRLRLFLEQFSIPTCVLNGELPLRSRCHI
  ISQFNQGFYDCVIATDAEVLGAPVKGKRRGRGPKGDKASDPEAGVARGIDFHHVSAVLNFDLPPTPEAYIHRAGR
  TARANNPGIVLTFVLPTEQFHLGKIEELLSGENRGPILLPYQFRMEEIEGFRYRCRDAMRSVTKQAIREARLKEI
  KEELLHSEKLKTYFEDNPRDLQLLRHDLPLHPAVVKPHLGHVPDYLVPPALRGLVRPHKKRKKLSSSCRKAKRAK
  SQNPLRSFKHKGKKFRPTAKPS

• Structural information:
  • Protein Domains: (38..21-)
    (/note="Helicase-ATP-binding)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00541-)
    (230..42-)
    (/note="Helicase-C-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00542"-)
  • Interpro: IPR011545  IPR014001  IPR001650  IPR027417  IPR014014  
  • Prosite: PS51192 PS51194 PS51195
  • STRING: ENSP00000258772
• Other Databases: GeneCards:  DDX56  Malacards:  DDX56

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005730	nucleolus	IBA	cellular component
GO:0003724	RNA helicase activity	IBA	molecular function
GO:0003723	RNA binding	IBA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0004386	helicase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0042254	ribosome biogenesis	IEA	biological process
GO:0006364	rRNA processing	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0003724	RNA helicase activity	TAS	molecular function
GO:0005730	nucleolus	TAS	cellular component
GO:0003724	RNA helicase activity	IEA	molecular function
GO:0005730	nucleolus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0010976	positive regulation of neuron projection development	IEA	biological process
GO:0005730	nucleolus	IEA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881