• Gene id: 54602

Gene Summary

• Gene Symbol: NDFIP2   Gene   UCSC   Ensembl
• Aliases: N4WBP5A
• Gene name: Nedd4 family interacting protein 2
• Alternate names: NEDD4 family-interacting protein 2, MAPK-activating protein PM04 PM05 PM06 PM07, NEDD4 WW domain-binding protein 5A, NF-kappa-B-activating protein 413, putative MAPK-activating protein PM04/PM05/PM06/PM07, putative NF-kappa-B-activating protein 413,
• Gene location: 13q31.1 (79480721: 79556076)     Exons: 8     NC_000013.11
• OMIM: 610041

Protein Summary

• Protein general information: Q9NV92  
  • Name: NEDD4 family interacting protein 2 (NEDD4 WW domain binding protein 5A) (Putative MAPK activating protein PM04/PM05/PM06/PM07) (Putative NF kappa B activating protein 413)
  • Length: 336  
  • Mass: 36390
  • Tissue specificity: Expressed in brain, lung, heart, skeletal muscle, kidney, liver and placenta. {ECO
• Sequence:

  MARRRSQRVCASGPSMLNSARGAPELLRGTATNAEVSAAAAGATGSEELPPGDRGCRNGGGRGPAATTSSTGVAV
  GAEHGEDSLSRKPDPEPGRMDHHQPGTGRYQVLLNEEDNSESSAIEQPPTSNPAPQIVQAASSAPALETDSSPPP
  YSSITVEVPTTSDTEVYGEFYPVPPPYSVATSLPTYDEAEKAKAAAMAAAAAETSQRIQEEECPPRDDFSDADQL
  RVGNDGIFMLAFFMAFIFNWLGFCLSFCITNTIAGRYGAICGFGLSLIKWILIVRFSDYFTGYFNGQYWLWWIFL
  VLGLLLFFRGFVNYLKVRNMSESMAAAHRTRYFFLL

• Structural information:
  • Interpro: IPR019325  
  • STRING: ENSP00000480798
• Other Databases: GeneCards:  NDFIP2  Malacards:  NDFIP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050699	WW domain binding	IBA	molecular function
GO:0048471	perinuclear region of cytoplasm	IBA	cellular component
GO:0030001	metal ion transport	IBA	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0031398	positive regulation of protein ubiquitination	IBA	biological process
GO:0030001	metal ion transport	IEA	biological process
GO:0007034	vacuolar transport	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0050699	WW domain binding	IPI	molecular function
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0032585	multivesicular body membrane	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0010008	endosome membrane	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0032410	negative regulation of transporter activity	IMP	biological process
GO:0031398	positive regulation of protein ubiquitination	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	HMP	biological process
GO:0051224	negative regulation of protein transport	IMP	biological process
GO:0010629	negative regulation of gene expression	IMP	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)